PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

MYB

Protein Properties

Length: 216aa MW: 25055.5 Da PI: 6.3719

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MELO3C022047P1	genome	MELONOMICS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	61.3	2e-19	11	58	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT eEd+ll ++vk +G g+W+++a+ g++Rt+k+c++rw +yl MELO3C022047P1 11 KGPWTVEEDKLLCEYVKVHGEGRWSSVAKGSGLNRTGKSCRLRWVNYL 58 79********************************************97 PP
2	Myb_DNA-binding	51	3.2e-16	64	108	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg T++E+ +++++++++G++ W+tIa++++ gRt++++k++w+++ MELO3C022047P1 64 RGHLTPQEEGIIIELHALWGNK-WSTIAKYLP-GRTDNEIKNYWRTH 108 6778****************.*****.**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	25.51	6	62	IPR017930	Myb domain
SuperFamily	SSF46689	1.07E-31	9	105	IPR009057	Homeodomain-like
SMART	SM00717	5.0E-17	10	60	IPR001005	SANT/Myb domain
Pfam	PF00249	7.2E-18	11	58	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.3E-23	12	65	IPR009057	Homeodomain-like
CDD	cd00167	1.10E-11	13	58	No hit	No description
PROSITE profile	PS51294	19.776	63	113	IPR017930	Myb domain
SMART	SM00717	6.2E-14	63	111	IPR001005	SANT/Myb domain
Pfam	PF00249	1.2E-14	64	108	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	6.0E-24	66	111	IPR009057	Homeodomain-like
CDD	cd00167	1.23E-9	68	109	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009737	Biological Process	response to abscisic acid
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 216 aa Download sequence Send to blast
MDGKEEQEWR KGPWTVEEDK LLCEYVKVHG EGRWSSVAKG SGLNRTGKSC RLRWVNYLKP 60 GLKRGHLTPQ EEGIIIELHA LWGNKWSTIA KYLPGRTDNE IKNYWRTHFK KMKPKPRRKS 120 QIIVPKTDNK TLPPISRCEE RVMELMKPYD SDDLGMVFTD PTAMEDHEQT YYLSKVYQDL 180 TNWTVESGAV AAVVAEQEEE SLWDGLWEVP ENDIM*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	7e-26	11	111	7	106	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. {ECO:0000305}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00388	DAP	Transfer from AT3G30210	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Isoform MYB59-1 is induced by jasmonate (JA), salicylic acid (SA), gibberellic acid (GA), and ethylene. Also induced by cadmium (Cd). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:16531467}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681889	0.0	LN681889.1 Cucumis melo genomic scaffold, anchoredscaffold00051.
GenBank	LN713263	0.0	LN713263.1 Cucumis melo genomic chromosome, chr_9.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008459705.1	1e-159	PREDICTED: transcription factor MYB59-like
Swissprot	Q4JL84	2e-50	MYB59_ARATH; Transcription factor MYB59
TrEMBL	A0A1S3CAT1	1e-158	A0A1S3CAT1_CUCME; transcription factor MYB59-like
STRING	XP_008459705.1	1e-159	(Cucumis melo)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1182	34	108

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G30210.1	2e-64	myb domain protein 121

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Nishida S,Kakei Y,Shimada Y,Fujiwara T Genome-wide analysis of specific alterations in transcript structure and accumulation caused by nutrient deficiencies in Arabidopsis thaliana. Plant J., 2017. 91(4): p. 741-753 [PMID:28586097] Hickman R, et al. Architecture and Dynamics of the Jasmonic Acid Gene Regulatory Network. Plant Cell, 2017. 29(9): p. 2086-2105 [PMID:28827376]