PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MELO3C019620P1

Organism

Cucumis melo

Taxonomic ID

3656

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

NAC

Protein Properties

Length: 163aa MW: 19017.9 Da PI: 10.2724

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MELO3C019620P1	genome	MELONOMICS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	182.3	1.2e-56	6	133	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 lppGfrFhPtdeelv +yL +k++g+++el e+i+e+d+yk+ePw+Lp k + +++ ewyf+s+rd+ky++g+r+nratk gyWkatgkd+ v MELO3C019620P1 6 LPPGFRFHPTDEELVAYYLDRKINGRSIEL-EIIPEIDLYKCEPWELPdKsFLPSKDMEWYFYSPRDRKYPNGSRTNRATKGGYWKATGKDRVVQ 99 79**************************.99**********96435566888******************************999 PP NAM 94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128 s ++++vg+kktLv+ykgrap+g++t+Wvmheyrl MELO3C019620P1 100 S-QKRAVGMKKTLVYYKGRAPHGVRTNWVMHEYRL 133 9.9999*************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	5.62E-62	3	138	IPR003441	NAC domain
PROSITE profile	PS51005	56.344	6	156	IPR003441	NAC domain
Pfam	PF02365	4.9E-30	7	133	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 163 aa Download sequence Send to blast
MAPMTLPPGF RFHPTDEELV AYYLDRKING RSIELEIIPE IDLYKCEPWE LPDKSFLPSK 60 DMEWYFYSPR DRKYPNGSRT NRATKGGYWK ATGKDRVVQS QKRAVGMKKT LVYYKGRAPH 120 GVRTNWVMHE YRLLHSQLAT AATSSPSTKV FFLFHSHFRV RV*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	2e-56	1	143	12	152	NO APICAL MERISTEM PROTEIN
1ut4_B	2e-56	1	143	12	152	NO APICAL MERISTEM PROTEIN
1ut7_A	2e-56	1	143	12	152	NO APICAL MERISTEM PROTEIN
1ut7_B	2e-56	1	143	12	152	NO APICAL MERISTEM PROTEIN
3swm_A	2e-56	1	143	15	155	NAC domain-containing protein 19
3swm_B	2e-56	1	143	15	155	NAC domain-containing protein 19
3swm_C	2e-56	1	143	15	155	NAC domain-containing protein 19
3swm_D	2e-56	1	143	15	155	NAC domain-containing protein 19
3swp_A	2e-56	1	143	15	155	NAC domain-containing protein 19
3swp_B	2e-56	1	143	15	155	NAC domain-containing protein 19
3swp_C	2e-56	1	143	15	155	NAC domain-containing protein 19
3swp_D	2e-56	1	143	15	155	NAC domain-containing protein 19
4dul_A	2e-56	1	143	12	152	NAC domain-containing protein 19
4dul_B	2e-56	1	143	12	152	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269\|PubMed:25081480}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00205	DAP	Transfer from AT1G54330	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681921	0.0	LN681921.1 Cucumis melo genomic scaffold, anchoredscaffold00039.
GenBank	LN713265	0.0	LN713265.1 Cucumis melo genomic chromosome, chr_11.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008456283.1	1e-108	PREDICTED: NAC domain-containing protein 76
Swissprot	Q9FFI5	5e-81	NAC86_ARATH; NAC domain-containing protein 86
TrEMBL	A0A1S3C450	1e-106	A0A1S3C450_CUCME; NAC domain-containing protein 76
STRING	XP_008456283.1	1e-107	(Cucumis melo)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF10508	33	41

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G54330.1	3e-85	NAC domain containing protein 20

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546]