PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C018242P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 257aa MW: 28368.8 Da PI: 9.4929 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 100.7 | 2.1e-31 | 3 | 76 | 54 | 128 |
NAM 54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk + + +g++vg+kk Lvfy g+apkg+kt+W+mheyrl MELO3C018242P1 3 GEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIIST-QGKKVGIKKALVFYVGKAPKGTKTNWIMHEYRL 76 579********************************999988.999****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 42.156 | 1 | 99 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 5.1E-41 | 2 | 100 | IPR003441 | NAC domain |
Pfam | PF02365 | 8.5E-15 | 7 | 76 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009414 | Biological Process | response to water deprivation | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 257 aa Download sequence Send to blast |
MFGEKEWYFF SPRDRKYPNG SRPNRVAGSG YWKATGTDKI ISTQGKKVGI KKALVFYVGK 60 APKGTKTNWI MHEYRLIDTS RKTGSTKLDD WVLCRIYKKN SSAQKLPPMT SSISSMECSN 120 GGSSSTCSSS HLDDVLESLP EIKDGLFSLP RVNSLLTLQQ DHENLKFQNH LMGSTNFDWA 180 SAAAGTSFEG YNSVAELAPL TQSQAPSGLI SSDMYIPACQ PPRSTAEQEV QSGFQRFHNF 240 GWLQKNFSNS GNGFGF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 4e-67 | 1 | 105 | 67 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 4e-67 | 1 | 105 | 67 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 4e-67 | 1 | 105 | 67 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 4e-67 | 1 | 105 | 67 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 4e-67 | 1 | 105 | 70 | 174 | NAC domain-containing protein 19 |
3swm_B | 4e-67 | 1 | 105 | 70 | 174 | NAC domain-containing protein 19 |
3swm_C | 4e-67 | 1 | 105 | 70 | 174 | NAC domain-containing protein 19 |
3swm_D | 4e-67 | 1 | 105 | 70 | 174 | NAC domain-containing protein 19 |
3swp_A | 4e-67 | 1 | 105 | 70 | 174 | NAC domain-containing protein 19 |
3swp_B | 4e-67 | 1 | 105 | 70 | 174 | NAC domain-containing protein 19 |
3swp_C | 4e-67 | 1 | 105 | 70 | 174 | NAC domain-containing protein 19 |
3swp_D | 4e-67 | 1 | 105 | 70 | 174 | NAC domain-containing protein 19 |
4dul_A | 4e-67 | 1 | 105 | 67 | 171 | NAC domain-containing protein 19 |
4dul_B | 4e-67 | 1 | 105 | 67 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts downstream of MYC2 in the jasmonate-mediated response to Botrytis cinerea infection (PubMed:28733419). With MYC2 forms a transcription module that regulates wounding-responsive genes (PubMed:28733419). Involved in jasmonate- and coronatine-mediated stomatal reopening in response to Pseudomonas syringae pv tomato DC3000 infection (PubMed:25005917). Regulates the expression of threonine deaminase 2 (TD2) through promoter binding (PubMed:28733419). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by jasmonate (JA) (PubMed:25005917, PubMed:28733419, PubMed:30610166). Induced by wounding (PubMed:28733419, PubMed:25005917). Induced by infection with the fungal pathogen Botrytis cinerea (PubMed:28733419). Induced by coronatine (PubMed:25005917). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419, ECO:0000269|PubMed:30610166}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681826 | 0.0 | LN681826.1 Cucumis melo genomic scaffold, anchoredscaffold00032. | |||
GenBank | LN713258 | 0.0 | LN713258.1 Cucumis melo genomic chromosome, chr_4. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008454666.1 | 0.0 | PREDICTED: NAC domain-containing protein 72-like | ||||
Swissprot | A0A3Q7HH64 | 3e-80 | JA2L_SOLLC; NAC domain-containing protein JA2L | ||||
TrEMBL | A0A1S3C0D5 | 0.0 | A0A1S3C0D5_CUCME; NAC domain-containing protein 72-like | ||||
STRING | XP_008454666.1 | 0.0 | (Cucumis melo) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G27410.2 | 3e-80 | NAC family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|