![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C017638P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 159aa MW: 18136.6 Da PI: 10.5675 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 41.4 | 3.2e-13 | 73 | 118 | 2 | 47 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++W++eE+ ++ + k+lG+g+W+ I++ ++Rt+ q+ s+ qky MELO3C017638P1 73 KPWSEEEHRTFLIGLKKLGKGDWRGISKNYVTTRTPTQVASHAQKY 118 58*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 19.439 | 67 | 123 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.12E-16 | 69 | 121 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 4.9E-17 | 70 | 122 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 1.5E-11 | 71 | 118 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.7E-9 | 71 | 121 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.0E-11 | 73 | 118 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.98E-8 | 74 | 119 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 159 aa Download sequence Send to blast |
MENRDESMRK SLSMGNLNLH SSCNNVLDLN NNTTAVNNVT GDNAASADDS GYLSDGLIHN 60 KRRKAAHERK KGKPWSEEEH RTFLIGLKKL GKGDWRGISK NYVTTRTPTQ VASHAQKYFL 120 RKMNANDKKK RRASLFDIPE IKVTILIYSF FFFFFLHL* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 127 | 131 | KKKRR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00573 | DAP | Transfer from AT5G61620 | Download |
![]() |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681874 | 1e-146 | LN681874.1 Cucumis melo genomic scaffold, anchoredscaffold00031. | |||
GenBank | LN713261 | 1e-146 | LN713261.1 Cucumis melo genomic chromosome, chr_7. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008453854.1 | 1e-101 | PREDICTED: transcription factor MYB1R1 | ||||
Swissprot | Q9FKF9 | 1e-52 | M5162_ARATH; Probable transcription factor At5g61620 | ||||
TrEMBL | A0A1S3BXC8 | 1e-99 | A0A1S3BXC8_CUCME; transcription factor MYB1R1 | ||||
STRING | XP_008453854.1 | 1e-100 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF13874 | 19 | 21 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G61620.1 | 3e-50 | MYB_related family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|