![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C015277P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 161aa MW: 17520 Da PI: 10.5335 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 61.1 | 1.4e-19 | 19 | 51 | 1 | 33 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkk 33 C+ C+ttkTplWR gp g+k+LCnaCG+++rk+ MELO3C015277P1 19 CVDCKTTKTPLWRGGPTGPKSLCNACGIRFRKR 51 *******************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 4.2E-14 | 13 | 65 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 3.85E-13 | 16 | 68 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 1.4E-15 | 17 | 52 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 4.38E-14 | 19 | 71 | No hit | No description |
PROSITE profile | PS50114 | 12.585 | 19 | 67 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 19 | 44 | IPR000679 | Zinc finger, GATA-type |
Pfam | PF00320 | 2.4E-17 | 19 | 51 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 161 aa Download sequence Send to blast |
MGFVDLSQKG LLLADTKCCV DCKTTKTPLW RGGPTGPKSL CNACGIRFRK RKIFTRRTNR 60 GGRDKKRERV RDNHSSTVAI VSATTTSSSG TTTTTTTTSG VDGDENSGEC GSSRMKIMMG 120 LEEDVMVVKK HRWQWQRKVG EEEKQAAVSL MALSNGSLIS * |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681806 | 0.0 | LN681806.1 Cucumis melo genomic scaffold, anchoredscaffold00025. | |||
GenBank | LN713256 | 0.0 | LN713256.1 Cucumis melo genomic chromosome, chr_2. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008450587.1 | 1e-113 | PREDICTED: GATA transcription factor 16-like | ||||
TrEMBL | A0A1S3BQ71 | 1e-112 | A0A1S3BQ71_CUCME; GATA transcription factor 16-like | ||||
STRING | XP_008450586.1 | 7e-96 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1569 | 32 | 98 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G49300.1 | 6e-10 | GATA transcription factor 16 |