PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C012873P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 165aa MW: 19222.3 Da PI: 9.7348 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 163.4 | 8.4e-51 | 10 | 138 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 lppGfrF P+deelv++yL kk+ ++++ ++ e+d++++ePw+Lp+ +k +++ewyfFs rd+kyatg r+nrat+ gyWkatgkd++v++ MELO3C012873P1 10 LPPGFRFYPSDEELVCHYLYKKIMNEQVLK-GTLVEIDLHTCEPWQLPEVAKLNSNEWYFFSFRDRKYATGFRTNRATTCGYWKATGKDRTVVDP 103 79************************9655.78***************88888999*************************************99 PP NAM 96 .kgelvglkktLvfykgrapkgektdWvmheyrle 129 +g vg++ktLvfyk+rap+g kt W+mhe+rle MELO3C012873P1 104 sTGDIVGMRKTLVFYKNRAPNGIKTGWIMHEFRLE 138 78888***************************985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 6.41E-56 | 8 | 142 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 52.365 | 10 | 158 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.8E-28 | 11 | 137 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 165 aa Download sequence Send to blast |
MGLKDIGASL PPGFRFYPSD EELVCHYLYK KIMNEQVLKG TLVEIDLHTC EPWQLPEVAK 60 LNSNEWYFFS FRDRKYATGF RTNRATTCGY WKATGKDRTV VDPSTGDIVG MRKTLVFYKN 120 RAPNGIKTGW IMHEFRLEAP HRPPKVEFFI LFFKFFFKFS LSIV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 2e-44 | 9 | 137 | 14 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for axillary meristem initiation and separation of the meristem from the main stem. May act as an inhibitor of cell division. {ECO:0000269|PubMed:12837947, ECO:0000269|PubMed:17122068}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. {ECO:0000269|PubMed:16854978}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681827 | 0.0 | LN681827.1 Cucumis melo genomic scaffold, anchoredscaffold00018. | |||
GenBank | LN713258 | 0.0 | LN713258.1 Cucumis melo genomic chromosome, chr_4. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004152054.1 | 1e-106 | PREDICTED: protein CUP-SHAPED COTYLEDON 3 | ||||
Refseq | XP_008447414.1 | 1e-106 | PREDICTED: protein CUP-SHAPED COTYLEDON 3-like | ||||
Swissprot | Q9S851 | 1e-56 | NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3 | ||||
TrEMBL | A0A0A0LB56 | 1e-105 | A0A0A0LB56_CUCSA; Uncharacterized protein | ||||
TrEMBL | A0A1S3BIA3 | 1e-105 | A0A1S3BIA3_CUCME; protein CUP-SHAPED COTYLEDON 3-like | ||||
STRING | XP_008447414.1 | 1e-106 | (Cucumis melo) | ||||
STRING | XP_004152054.1 | 1e-106 | (Cucumis sativus) | ||||
STRING | XP_004169258.1 | 1e-106 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF4381 | 33 | 59 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G28530.1 | 3e-81 | NAC domain containing protein 74 |
Publications ? help Back to Top | |||
---|---|---|---|
|