PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

bZIP

Protein Properties

Length: 167aa MW: 18755.9 Da PI: 4.7014

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MELO3C010967P1	genome	MELONOMICS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	44.2	4.2e-14	30	88	5	63
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 ++ +r+q+NRe+ArrsR RK++ ++eL v +L++ N + ++++ ++++ ++++e+ MELO3C010967P1 30 RKRKRMQSNRESARRSRMRKQQHLDELMAQVTQLKKDNAQILSNINITSQLYMNVEAEN 88 6789*****************************************99999988887776 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.20.5.170	2.5E-11	22	75	No hit	No description
SMART	SM00338	1.6E-18	26	90	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.588	28	75	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	1.1E-10	30	81	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	5.88E-12	30	83	No hit	No description
CDD	cd14702	9.12E-19	31	82	No hit	No description
PROSITE pattern	PS00036	0	33	48	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009845	Biological Process	seed germination
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 167 aa Download sequence Send to blast
MDSASGNSSG SIRLQNSGSE EDLQVLMDQR KRKRMQSNRE SARRSRMRKQ QHLDELMAQV 60 TQLKKDNAQI LSNINITSQL YMNVEAENSI LKAQMAELTQ RLQSLEEIAN CINNTGGNNN 120 GGFGETEEEE EAFQIQTIVA ADSFMNSMNF LYVNQPIMAA ADIFHY*

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	42	49	RRSRMRKQ

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the DNA G-box motif 5'-CACGTG-3' of MAN7 promoter. Involved in the positive regulation of seed germination through MAN7 gene activation. MAN7 is required for both, loosening of the micropylar endosperm, and rupture of the seed coat in germinating seeds. {ECO:0000269\|PubMed:23461773}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00239	DAP	Transfer from AT1G75390	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681823	0.0	LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014.
GenBank	LN713257	0.0	LN713257.1 Cucumis melo genomic chromosome, chr_3.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008444748.1	1e-119	PREDICTED: bZIP transcription factor 53
Swissprot	C0Z2L5	7e-46	BZP44_ARATH; bZIP transcription factor 44
TrEMBL	A0A1S3BB39	1e-117	A0A1S3BB39_CUCME; bZIP transcription factor 53
STRING	XP_008444748.1	1e-118	(Cucumis melo)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF613	34	147

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G75390.1	3e-47	basic leucine-zipper 44

Publications ? help Back to Top
Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470] Pedrotti L, et al. Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness. Plant Cell, 2018. 30(2): p. 495-509 [PMID:29348240]