PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

SBP

Protein Properties

Length: 143aa MW: 15908.3 Da PI: 6.8615

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MELO3C007273P2	genome	MELONOMICS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	134.7	2.9e-42	56	131	1	76
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 +Cq++gC+adl+ a+ yhrrhkvCe+h+ka+vv+++gleqrfCqqCsrfh++sefD++krsCr+rLa+hnerrrk MELO3C007273P2 56 RCQADGCNADLTGARPYHRRHKVCEFHAKAAVVILAGLEQRFCQQCSRFHAVSEFDDTKRSCRSRLAGHNERRRKI 131 6*************************************************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:4.10.1100.10	4.0E-35	49	118	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	31.684	54	131	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	2.85E-39	55	135	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	4.3E-33	57	130	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 143 aa Download sequence Send to blast
MANSNDHSWE DMILDDDDDD DNDTEEVGFV DNERRRRSGL TTGRGGGGGG RSTVARCQAD 60 GCNADLTGAR PYHRRHKVCE FHAKAAVVIL AGLEQRFCQQ CSRFHAVSEF DDTKRSCRSR 120 LAGHNERRRK ILPDFHGQSS TN*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	3e-35	47	130	1	84	squamosa promoter binding protein-like 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681875	1e-173	LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBank	LN713262	1e-173	LN713262.1 Cucumis melo genomic chromosome, chr_8.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008439842.1	1e-101	PREDICTED: squamosa promoter-binding protein 1
Swissprot	Q38741	7e-40	SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBL	A0A1S3AZN8	1e-100	A0A1S3AZN8_CUCME; squamosa promoter-binding protein 1
STRING	XP_008439842.1	1e-101	(Cucumis melo)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF535	34	153

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G02065.1	1e-37	squamosa promoter binding protein-like 8

Publications ? help Back to Top
Klein J,Saedler H,Huijser P A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA. Mol. Gen. Genet., 1996. 250(1): p. 7-16 [PMID:8569690]