 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
MDP0000854639 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
| Family |
MYB_related |
| Protein Properties |
Length: 116aa MW: 13311.6 Da PI: 10.3417 |
| Description |
MYB_related family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| MDP0000854639 | genome | GDR | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Myb_DNA-binding | 49 | 1.4e-15 | 30 | 77 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g W++eEde+l ++ G g+W+ Iar g+ R++k+c++rw +yl
MDP0000854639 30 KGLWSPEEDEKLMRYMLTSGQGCWSDIARNAGLQRCGKSCRLRWINYL 77
678*******************************************97 PP
|
| Expression --
Description ? help
Back to Top |
| Source |
Description |
| Uniprot | TISSUE SPECIFICITY: Expressed at low levels in stems and siliques, specifically in xylem. {ECO:0000269|PubMed:16581911, ECO:0000269|PubMed:17890373, ECO:0000269|PubMed:9839469}. |
| Uniprot | TISSUE SPECIFICITY: Expressed specifically in fiber and vessel cells that are undergoing secondary wall thickening in floral stems. Expressed in vessels but not in xylary fibers in the developing secondary xylem of roots. {ECO:0000269|PubMed:19808805}. |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcription activator. Involved in the regulation of secondary wall biosynthesis in fibers and vessels (PubMed:17890373). Transcription activator of the mannan synthase CSLA9 that recognizes and binds to the DNA consensus sequence 5'-[AG][GT]T[AT]GGT[GA]-3' cis-regulatory element of CSLA9 promoter (PubMed:24243147). Transcription factor that acts as molecular switch in the NAC012/SND1-mediated transcriptional network regulating secondary wall biosynthesis. Is directly activated by NAC012/SND1. Functions redundantly with MYB83 in the transcriptional regulatory cascade leading to secondary wall formation in fibers and vessels (PubMed:19808805). Transcription activator that binds to the DNA consensus sequence 5'-ACC[AT]A[AC][TC]-3', designated as the secondary wall MYB-responsive element (SMRE). Regulates directly numerous transcription factors and a number of genes involved in secondary wall biosynthesis that contain SMRE elements in their promoters (PubMed:22197883). Is an obligate component of the transcriptional regulatory complex toward the commitment of secondary wall cellulose synthesis. Is required for functional expression of the three secondary wall CESA genes, CESA4, CESA7 and CESA8 (PubMed:23726771). {ECO:0000269|PubMed:17890373, ECO:0000269|PubMed:19808805, ECO:0000269|PubMed:22197883, ECO:0000269|PubMed:23726771, ECO:0000269|PubMed:24243147}. |
| UniProt | Transcription factor that acts as molecular switch in the NAC012/SND1-mediated transcriptional network regulating secondary wall biosynthesis. Is directly activated by NAC012/SND1 and its close homologs, including NAC043/NST1, NAC066/NST2, NAC101/VND6 and NAC030/VND7. Is required for functional expression of a number of secondary wall-associated transcription factors and secondary wall biosynthetic genes involved in cellulose, xylan and lignin synthesis. Functions redundantly with MYB46 in the transcriptional regulatory cascade leading to secondary wall formation in fibers and vessels (PubMed:19808805). Transcription activator that binds to the DNA consensus sequence 5'-ACC[AT]A[AC][TC]-3', designated as the secondary wall MYB-responsive element (SMRE). Regulates directly numerous transcription factors and a number of genes involved in secondary wall biosynthesis that contain SMRE elements in their promoters (PubMed:22197883). {ECO:0000269|PubMed:19808805, ECO:0000269|PubMed:22197883}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: Slightly induced by salicylic acid (SA). Positively regulated by SND1 and homolog proteins. {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:17890373}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | AY970357 | 3e-84 | AY970357.1 Prunus salicina clone PSX08 microsatellite sequence. |
| Publications
? help Back to Top |
- Zhao Q, et al.
Pinoresinol reductase 1 impacts lignin distribution during secondary cell wall biosynthesis in Arabidopsis.
Phytochemistry, 2015. 112: p. 170-8
[PMID:25107662] - Sakamoto S,Mitsuda N
Reconstitution of a secondary cell wall in a secondary cell wall-deficient Arabidopsis mutant.
Plant Cell Physiol., 2015. 56(2): p. 299-310
[PMID:25535195] - Vargas L, et al.
Improving total saccharification yield of Arabidopsis plants by vessel-specific complementation of caffeoyl shikimate esterase (cse) mutants.
Biotechnol Biofuels, 2016. 9: p. 139
[PMID:27390589] - Piya S,Kihm C,Rice JH,Baum TJ,Hewezi T
Cooperative Regulatory Functions of miR858 and MYB83 during Cyst Nematode Parasitism.
Plant Physiol., 2017. 174(3): p. 1897-1912
[PMID:28512179] - Takeuchi M,Kegasa T,Watanabe A,Tamura M,Tsutsumi Y
Expression analysis of transporter genes for screening candidate monolignol transporters using Arabidopsis thaliana cell suspensions during tracheary element differentiation.
J. Plant Res., 2018. 131(2): p. 297-305
[PMID:28921082]
|
