![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MDP0000756254 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 64aa MW: 7385.64 Da PI: 9.3075 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 56.6 | 5.1e-18 | 6 | 42 | 23 | 59 |
EEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 23 sYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 sYYrCt+++C+vkk+v+r ++d+++v++tYeg Hnh+ MDP0000756254 6 SYYRCTHHTCNVKKQVQRLSKDTSIVVTTYEGIHNHP 42 9***********************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF118290 | 1.44E-14 | 5 | 43 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 15.135 | 6 | 44 | IPR003657 | WRKY domain |
SMART | SM00774 | 4.9E-8 | 6 | 43 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 4.9E-15 | 6 | 42 | IPR003657 | WRKY domain |
Pfam | PF03106 | 4.8E-13 | 6 | 42 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 64 aa Download sequence Send to blast |
MILSGSYYRC THHTCNVKKQ VQRLSKDTSI VVTTYEGIHN HPCEKLMETL TPLLKQMQFL 60 SRF* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JF708959 | 2e-52 | JF708959.1 Dimocarpus longan WRKY transcription factor 23-1 mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021279718.1 | 1e-37 | probable WRKY transcription factor 43 | ||||
Swissprot | Q8VWQ4 | 6e-32 | WRK56_ARATH; Probable WRKY transcription factor 56 | ||||
Swissprot | Q9FFS3 | 5e-32 | WRK24_ARATH; Probable WRKY transcription factor 24 | ||||
TrEMBL | A0A059C012 | 1e-35 | A0A059C012_EUCGR; Uncharacterized protein | ||||
STRING | XP_008344897.1 | 1e-36 | (Malus domestica) | ||||
STRING | XP_010055075.1 | 2e-36 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF3227 | 34 | 71 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G41570.1 | 2e-34 | WRKY DNA-binding protein 24 |
Link Out ? help Back to Top | |
---|---|
Phytozome | MDP0000756254 |