PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MDP0000566079 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 111aa MW: 12509 Da PI: 6.5092 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 28.8 | 1.5e-09 | 2 | 53 | 7 | 58 |
GRAS 7 ecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvs 58 + Ae +++++++la+al++++ la +++d+m +++++f+e +a+r++r + MDP0000566079 2 DXAETIQQNNFNLAKALVTQIDYLAGSQADAMCKVTTFFAETMAHRIFRVYP 53 579*********************************************9433 PP | |||||||
2 | GRAS | 24.1 | 4.1e-08 | 74 | 104 | 221 | 251 |
GRAS 221 eserdevLklvkslsPkvvvvveqeadhnse 251 ++++++vL +vk+++Pk+v+vveqe++hn++ MDP0000566079 74 PDAIENVLLVVKQMKPKIVTVVEQEVNHNGP 104 344578**********************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03514 | 5.1E-7 | 2 | 53 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 1.4E-5 | 74 | 104 | IPR005202 | Transcription factor GRAS |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 111 aa Download sequence Send to blast |
MDXAETIQQN NFNLAKALVT QIDYLAGSQA DAMCKVTTFF AETMAHRIFR VYPQSPIDHS 60 FSGMLYIHFY ETRPDAIENV LLVVKQMKPK IVTVVEQEVN HNGPSRRSEG * |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that represses transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008372912.2 | 5e-78 | DELLA protein GAI1-like | ||||
Swissprot | Q6EI05 | 3e-24 | GAIPB_CUCMA; DELLA protein GAIP-B | ||||
TrEMBL | A1YIQ8 | 1e-31 | A1YIQ8_MALHU; GAI1 | ||||
STRING | XP_008372912.1 | 2e-77 | (Malus domestica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF38574 | 2 | 2 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G01570.1 | 6e-22 | GRAS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | MDP0000566079 |