![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MDP0000401351 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 119aa MW: 13170.1 Da PI: 8.4957 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 52 | 9.5e-17 | 7 | 40 | 2 | 35 |
GATA 2 snCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 ++Cgt +Tp+WR gp gnktLC aC ++yrk g+ MDP0000401351 7 QHCGTETTPQWRPGPHGNKTLCDACEVRYRKSGK 40 69*****************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50114 | 10.211 | 1 | 55 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 1.3E-8 | 2 | 51 | IPR000679 | Zinc finger, GATA-type |
Pfam | PF00320 | 1.1E-14 | 7 | 40 | IPR000679 | Zinc finger, GATA-type |
CDD | cd00202 | 2.51E-12 | 7 | 55 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 1.7E-11 | 7 | 41 | IPR013088 | Zinc finger, NHR/GATA-type |
SuperFamily | SSF57716 | 4.51E-13 | 8 | 61 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 119 aa Download sequence Send to blast |
MIGRKGQHCG TETTPQWRPG PHGNKTLCDA CEVRYRKSGK LVPEYCPASS PTFSRELHSN 60 NLSKVMNLGH VVGAFPFVVW ADLDLLVWAR LSYVGQCSIL NYDERNSNLS HIVLTALL* |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Mostly expressed in roots. Also expressed in stems, flowers and leaves. {ECO:0000269|PubMed:12139008}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004497744.2 | 1e-24 | GATA transcription factor 1 | ||||
Refseq | XP_007034503.1 | 1e-24 | PREDICTED: GATA transcription factor 1 | ||||
Refseq | XP_021595256.1 | 1e-24 | GATA transcription factor 1-like | ||||
Refseq | XP_027189964.1 | 1e-24 | GATA transcription factor 1 | ||||
Swissprot | Q8LAU9 | 2e-24 | GATA1_ARATH; GATA transcription factor 1 | ||||
TrEMBL | W9R3B3 | 3e-24 | W9R3B3_9ROSA; GATA transcription factor 1 | ||||
STRING | XP_010097024.1 | 5e-25 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF8537 | 29 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G24050.1 | 7e-27 | GATA transcription factor 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | MDP0000401351 |