![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MDP0000270078 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 74aa MW: 8448.17 Da PI: 4.1712 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 33.6 | 9.2e-11 | 26 | 67 | 2 | 45 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
+ ++++E+ l+++ ++ G + W++Ia +++ gRt++++ +w
MDP0000270078 26 LQFSEDEEALIIRMYNLVGER-WALIAGRIP-GRTAEEIEKYWS 67
579******************.*********.***********5 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 11.654 | 20 | 74 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.7E-7 | 24 | 72 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.3E-13 | 27 | 68 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 5.46E-9 | 27 | 70 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 7.9E-10 | 27 | 66 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 3.60E-8 | 28 | 66 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 74 aa Download sequence Send to blast |
MADSEHSSSD DTVVDSREKS TEKSELQFSE DEEALIIRMY NLVGERWALI AGRIPGRTAE 60 EIEKYWSSTY STSQ |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in developing trichomes and non-root hair cells. {ECO:0000269|PubMed:15063185, ECO:0000269|PubMed:15584952}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. {ECO:0000269|PubMed:15063185, ECO:0000269|PubMed:15584952}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008345831.1 | 3e-47 | MYB-like transcription factor ETC1 | ||||
| Swissprot | Q9LNI5 | 1e-16 | ETC1_ARATH; MYB-like transcription factor ETC1 | ||||
| TrEMBL | A0A498JU26 | 8e-46 | A0A498JU26_MALDO; Uncharacterized protein | ||||
| STRING | XP_008345831.1 | 1e-46 | (Malus domestica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF2692 | 31 | 78 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G01380.1 | 4e-19 | MYB_related family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | MDP0000270078 |




