![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MDP0000228942 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 107aa MW: 12032.1 Da PI: 11.3909 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 87.3 | 8.4e-28 | 55 | 104 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ri+n++ rqvtfskRr g+lKKA+ELS+LCdaev +i+fs tg+ly+y+s MDP0000228942 55 RIDNSTSRQVTFSKRRSGLLKKAKELSILCDAEVGLIVFSGTGRLYDYAS 104 8***********************************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 31.511 | 46 | 106 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.2E-38 | 46 | 105 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 8.05E-38 | 47 | 107 | No hit | No description |
SuperFamily | SSF55455 | 1.44E-27 | 47 | 107 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 48 | 102 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.9E-29 | 48 | 68 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.4E-25 | 55 | 102 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.9E-29 | 68 | 83 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.9E-29 | 83 | 104 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 107 aa Download sequence Send to blast |
MRIEKAKPQF PERKRAPFGF PNKTCQSSIR LRLSSIRLPG PLEEGMGRGK IVIRRIDNST 60 SRQVTFSKRR SGLLKKAKEL SILCDAEVGL IVFSGTGRLY DYASTSM |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 7e-21 | 46 | 107 | 1 | 62 | MEF2C |
5f28_B | 7e-21 | 46 | 107 | 1 | 62 | MEF2C |
5f28_C | 7e-21 | 46 | 107 | 1 | 62 | MEF2C |
5f28_D | 7e-21 | 46 | 107 | 1 | 62 | MEF2C |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Specifically expressed in roots, mostly in lateral roots (LR) primordia, young emerging LRs, apex and base of LRs, apex of the primary root, and in the stele. Barely detectable in shoots. {ECO:0000269|PubMed:12837945, ECO:0000269|PubMed:16021502, ECO:0000269|PubMed:17148611, ECO:0000269|PubMed:9430595}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Required for root plasticity in response to nitrate, NO(3)(-). Promotes lateral root growth in a NRT1.1-dependent manner. {ECO:0000269|PubMed:15667327, ECO:0000269|PubMed:17148611, ECO:0000269|PubMed:9430595}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by nitrate in root cell culture, (PubMed:9430595, PubMed:17148611). In roots, seems induced by nitrogen (N) deprivation (e.g. nitrate free medium) but rapidly repressed by N re-supply (e.g. nitrate, glutamine and ammonium) (PubMed:16021502). Slight repression in shoots during nitrogen (N) deprivation. {ECO:0000269|PubMed:16021502, ECO:0000269|PubMed:17148611, ECO:0000269|PubMed:9430595}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KP164022 | 1e-79 | KP164022.1 Pyrus pyrifolia clone PpAGL17 AGL17-like MADS-box protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024166977.1 | 1e-35 | MADS-box transcription factor ANR1-like isoform X6 | ||||
Refseq | XP_028959464.1 | 2e-35 | MADS-box transcription factor 23-like | ||||
Swissprot | Q9SI38 | 2e-33 | ANR1_ARATH; MADS-box transcription factor ANR1 | ||||
TrEMBL | A0A068TMB1 | 6e-34 | A0A068TMB1_COFCA; Uncharacterized protein | ||||
TrEMBL | A0A251MUM3 | 3e-33 | A0A251MUM3_PRUPE; Uncharacterized protein | ||||
TrEMBL | A0A2I0A9Y4 | 7e-34 | A0A2I0A9Y4_9ASPA; MADS-box transcription factor 27 | ||||
TrEMBL | A0A498K3V7 | 5e-34 | A0A498K3V7_MALDO; Uncharacterized protein | ||||
STRING | XP_004289825.1 | 3e-34 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF119 | 33 | 360 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G14210.1 | 5e-36 | AGAMOUS-like 44 |
Link Out ? help Back to Top | |
---|---|
Phytozome | MDP0000228942 |
Publications ? help Back to Top | |||
---|---|---|---|
|