![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MA_9896333g0010 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 106aa MW: 12258.2 Da PI: 5.2105 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 115.4 | 7.2e-36 | 2 | 90 | 231 | 319 |
GRAS 231 vkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerl 319 ksl+Pkvv+vveqe+++n+++Fl rf+e ++yys++f+sl+a+l+res +r++vE+++l+r+ivn++aceg+er+er e +kWr+r+ MA_9896333g0010 2 AKSLNPKVVTVVEQEVNTNTAPFLPRFMEVINYYSSVFESLDATLSRESIDRVNVEKKCLARDIVNIIACEGEERIERYEVTGKWRARM 90 79**************************************************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50985 | 21.358 | 1 | 106 | IPR005202 | Transcription factor GRAS |
Pfam | PF03514 | 2.5E-33 | 2 | 90 | IPR005202 | Transcription factor GRAS |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 106 aa Download sequence Send to blast |
MAKSLNPKVV TVVEQEVNTN TAPFLPRFME VINYYSSVFE SLDATLSRES IDRVNVEKKC 60 LARDIVNIIA CEGEERIERY EVTGKWRARM LWQDLVCILS VLMSRT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5hyz_A | 1e-16 | 1 | 92 | 228 | 320 | GRAS family transcription factor containing protein, expressed |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in plant development. {ECO:0000250}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT106412 | 1e-156 | BT106412.1 Picea glauca clone GQ03001_C01 mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002302201.2 | 4e-48 | scarecrow-like protein 1 | ||||
Refseq | XP_024450876.1 | 4e-48 | scarecrow-like protein 1 | ||||
Refseq | XP_024450877.1 | 4e-48 | scarecrow-like protein 1 | ||||
Swissprot | Q9SDQ3 | 4e-45 | SCL1_ARATH; Scarecrow-like protein 1 | ||||
TrEMBL | A0A0B4U7X1 | 3e-51 | A0A0B4U7X1_PINRA; SCL7 (Fragment) | ||||
STRING | POPTR_0002s07430.1 | 1e-47 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP10802 | 2 | 9 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G21450.1 | 2e-37 | SCARECROW-like 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|