![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MA_9196648g0010 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 94aa MW: 10472.9 Da PI: 7.0844 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 24.5 | 6.2e-08 | 44 | 81 | 5 | 44 |
-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 ++eE++l+ +++k+lG + W++Ia +++ R +++ ++ MA_9196648g0010 44 SAEEEDLINRLHKLLGDR-WALIAGRLP-WRRVEEIENYC 81 79**************99.*********.*****999986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 3.6E-5 | 39 | 87 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.17E-5 | 42 | 80 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 4.6E-7 | 44 | 82 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.01E-5 | 44 | 83 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 6.3E-9 | 44 | 80 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 94 aa Download sequence Send to blast |
MKGFSLPKAE GDCNVTWPGG GMISSRGSNL EYCQKSDCAA RDISAEEEDL INRLHKLLGD 60 RWALIAGRLP WRRVEEIENY CKMRYTAAAS SSCS |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT111033 | 2e-93 | BT111033.1 Picea glauca clone GQ03231_J08 mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
TrEMBL | A9NQX0 | 8e-18 | A9NQX0_PICSI; Uncharacterized protein |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP4207 | 8 | 23 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G01060.1 | 5e-14 | CAPRICE-like MYB3 |