PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea

Family

M-type_MADS

Protein Properties

Length: 78aa MW: 8999.6 Da PI: 10.5254

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MA_78010g0010	genome	ConGenIE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	104.2	4.4e-33	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifss+gklye+s+ MA_78010g0010 9 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFSN 59 79***********************************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	5.2E-43	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	34.132	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	2.62E-31	2	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.12E-40	2	60	No hit	No description
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.5E-34	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	4.9E-28	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.5E-34	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.5E-34	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 78 aa Download sequence Send to blast
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSVLCD AEVALIIFSS RGKLYEFSNK 60 RYGASKFLLT FPLLNEIP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	8e-22	1	76	1	74	MEF2C
5f28_B	8e-22	1	76	1	74	MEF2C
5f28_C	8e-22	1	76	1	74	MEF2C
5f28_D	8e-22	1	76	1	74	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in seed development. {ECO:0000269\|PubMed:29853599}.
UniProt	Probable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269\|PubMed:21447172, ECO:0000269\|PubMed:29853599, ECO:0000269\|Ref.1}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KC305492	3e-61	KC305492.1 Picea abies MADS-domain transcription factor DAL20 (Dal20) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_007146364.1	4e-35	hypothetical protein PHAVU_006G034400g
Swissprot	A0A217EJJ0	1e-34	AG11S_VITVI; Agamous-like MADS-box protein AGL11
Swissprot	F6I457	1e-34	AG11C_VITVI; Agamous-like MADS-box protein AGL11
TrEMBL	A0A453ED03	3e-36	A0A453ED03_AEGTS; Uncharacterized protein
STRING	Traes_3DS_51A589227.1	2e-36	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP16	17	761

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G58780.2	2e-37	MIKC_MADS family protein

Publications ? help Back to Top
Jaillon O, et al. The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla. Nature, 2007. 449(7161): p. 463-7 [PMID:17721507] Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ Genome-wide analysis of MIKCC-type MADS box genes in grapevine. Plant Physiol., 2009. 149(1): p. 354-69 [PMID:18997115] Mejía N, et al. Molecular, genetic and transcriptional evidence for a role of VvAGL11 in stenospermocarpic seedlessness in grapevine. BMC Plant Biol., 2011. 11: p. 57 [PMID:21447172] Grimplet J,Martínez-Zapater JM,Carmona MJ Structural and functional annotation of the MADS-box transcription factor family in grapevine. BMC Genomics, 2016. 17: p. 80 [PMID:26818751] Malabarba J, et al. The MADS-box gene Agamous-like 11 is essential for seed morphogenesis in grapevine. J. Exp. Bot., 2017. 68(7): p. 1493-1506 [PMID:28369525] Royo C, et al. The Major Origin of Seedless Grapes Is Associated with a Missense Mutation in the MADS-Box Gene VviAGL11. Plant Physiol., 2018. 177(3): p. 1234-1253 [PMID:29853599]