![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MA_35014g0010 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 173aa MW: 19533.9 Da PI: 6.3546 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 40.9 | 4.4e-13 | 52 | 110 | 5 | 63 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 ++++r+ +NRe+ArrsR RK++ ++eL+ +++ L aeN + + + + ++ +l+ e+ MA_35014g0010 52 RKQKRMLSNRESARRSRMRKQQHLDELRAEAAHLRAENNHMLTKFNIASHKYMQLEEEN 110 79***************************************999999888888888877 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 1.4E-10 | 43 | 95 | No hit | No description |
SMART | SM00338 | 4.7E-16 | 48 | 112 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.76 | 50 | 113 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 5.0E-10 | 52 | 110 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 4.88E-12 | 52 | 106 | No hit | No description |
CDD | cd14702 | 7.67E-23 | 53 | 104 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 55 | 70 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 173 aa Download sequence Send to blast |
MSPPPSYSMF PNSGMGLNPS VTSSEPSSQV SGSIPLHYSG SEEDPKQTID ERKQKRMLSN 60 RESARRSRMR KQQHLDELRA EAAHLRAENN HMLTKFNIAS HKYMQLEEEN SLLRSYATDL 120 SLKLQSLTIA MQWAGVLNDM DLDSSTGFMD TTDIKSCYLP SISQPLTSTE IYQ |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 64 | 71 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the DNA G-box motif 5'-CACGTG-3' of MAN7 promoter. Involved in the positive regulation of seed germination through MAN7 gene activation. MAN7 is required for both, loosening of the micropylar endosperm, and rupture of the seed coat in germinating seeds. {ECO:0000269|PubMed:23461773}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EF676762 | 0.0 | EF676762.1 Picea sitchensis clone WS02751_B16 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Swissprot | C0Z2L5 | 2e-24 | BZP44_ARATH; bZIP transcription factor 44 | ||||
TrEMBL | B8LLW5 | 1e-124 | B8LLW5_PICSI; Uncharacterized protein |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP551 | 16 | 78 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G18160.1 | 1e-20 | basic leucine-zipper 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|