![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MA_2008g0010 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 74aa MW: 8554.34 Da PI: 4.2449 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 33.8 | 7.8e-11 | 26 | 67 | 1 | 44 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 ++ ++++E++l+ ++ ++lG + W++Ia +++ gRt+ ++k + MA_2008g0010 26 KMDFSEDEEDLISRLYNLLGQR-WALIAGRIP-GRTADEIKKYC 67 5689*****************9.*********.********985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 9.204 | 18 | 74 | IPR017930 | Myb domain |
SMART | SM00717 | 2.1E-6 | 25 | 73 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.1E-10 | 26 | 67 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 5.15E-8 | 26 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 5.49E-7 | 29 | 67 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 3.9E-12 | 29 | 66 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 74 aa Download sequence Send to blast |
MSDMDRSSSD DNISVDSHDD VNESYKMDFS EDEEDLISRL YNLLGQRWAL IAGRIPGRTA 60 DEIKKYCSKR YVSD |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT101395 | 1e-122 | BT101395.1 Picea glauca clone GQ01303_H24 mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012086360.1 | 2e-27 | MYB-like transcription factor ETC1 | ||||
TrEMBL | A9NLI8 | 2e-45 | A9NLI8_PICSI; Uncharacterized protein | ||||
STRING | XP_002529738.1 | 3e-26 | (Ricinus communis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP3921 | 8 | 25 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G46410.1 | 2e-16 | MYB_related family protein |