![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MA_1130033g0010 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 145aa MW: 16817.2 Da PI: 6.2606 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 157.6 | 1.1e-48 | 1 | 144 | 230 | 373 |
GRAS 230 lvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaG 323 +vksl+ kvv+v+eqe+++n+++F +f+eal+yys++f+sl+a+l+res++r++vE+++l+r+ivn++aceg+e +er e ekWr+r+++a MA_1130033g0010 1 MVKSLNHKVVTVAEQEVNTNTAPFIPQFMEALNYYSSVFESLDATLSRESRDRVNVEKQCLARDIVNIIACEGEEMIERYEVTEKWRARMTMAR 94 69******************************************************************************************** PP GRAS 324 FkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373 F+++pls ++ +++k+ l+ + + y+ +ee g +++ W dr L+++SaW MA_1130033g0010 95 FSAYPLSANVKDTVKSFLHPSYCNSYKTKEEGGVMYFVWLDRILITTSAW 144 **********************999************************* PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03514 | 3.9E-46 | 1 | 144 | IPR005202 | Transcription factor GRAS |
PROSITE profile | PS50985 | 24.116 | 1 | 125 | IPR005202 | Transcription factor GRAS |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 145 aa Download sequence Send to blast |
MVKSLNHKVV TVAEQEVNTN TAPFIPQFME ALNYYSSVFE SLDATLSRES RDRVNVEKQC 60 LARDIVNIIA CEGEEMIERY EVTEKWRARM TMARFSAYPL SANVKDTVKS FLHPSYCNSY 120 KTKEEGGVMY FVWLDRILIT TSAWH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5b3g_A | 5e-20 | 1 | 144 | 237 | 378 | Protein SCARECROW |
5b3h_A | 5e-20 | 1 | 144 | 236 | 377 | Protein SCARECROW |
5b3h_D | 5e-20 | 1 | 144 | 236 | 377 | Protein SCARECROW |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in plant development. {ECO:0000250}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT106412 | 0.0 | BT106412.1 Picea glauca clone GQ03001_C01 mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010649367.1 | 1e-64 | PREDICTED: scarecrow-like protein 1 | ||||
Refseq | XP_019075083.1 | 1e-64 | PREDICTED: scarecrow-like protein 1 | ||||
Refseq | XP_019075084.1 | 1e-64 | PREDICTED: scarecrow-like protein 1 | ||||
Refseq | XP_019075085.1 | 1e-64 | PREDICTED: scarecrow-like protein 1 | ||||
Swissprot | Q9SDQ3 | 4e-61 | SCL1_ARATH; Scarecrow-like protein 1 | ||||
TrEMBL | A0A0B4U7X1 | 2e-88 | A0A0B4U7X1_PINRA; SCL7 (Fragment) | ||||
STRING | Aquca_014_00370.1 | 4e-64 | (Aquilegia coerulea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP10802 | 2 | 9 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G21450.1 | 2e-63 | SCARECROW-like 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|