![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MA_1118275g0010 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
Family | GRAS | ||||||||
Protein Properties | Length: 117aa MW: 13553.5 Da PI: 6.5156 | ||||||||
Description | GRAS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GRAS | 121.3 | 1.2e-37 | 1 | 116 | 258 | 373 |
GRAS 258 lealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrv 351 +eal+yys++f+sl+a+l+res++r++vE+++l+r+iv+++aceg+er+er e +ekWr+r+++a F+++pls ++ +++k+ll++ + + y+ MA_1118275g0010 1 MEALNYYSSVFESLDATLSRESRDRVNVEKQCLARDIVKIIACEGEERIERYEVAEKWRARMTMARFSAYPLSANVKDTVKSLLHQSYCNSYKT 94 69**************************************************************************************999*** PP GRAS 352 eeesgslvlgWkdrpLvsvSaW 373 +ee g++++gW d ++++SaW MA_1118275g0010 95 KEEGGAMYFGWLDIIIIVASAW 116 ********************** PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03514 | 4.1E-35 | 1 | 116 | IPR005202 | Transcription factor GRAS |
PROSITE profile | PS50985 | 19.534 | 1 | 97 | IPR005202 | Transcription factor GRAS |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 117 aa Download sequence Send to blast |
MEALNYYSSV FESLDATLSR ESRDRVNVEK QCLARDIVKI IACEGEERIE RYEVAEKWRA 60 RMTMARFSAY PLSANVKDTV KSLLHQSYCN SYKTKEEGGA MYFGWLDIII IVASAWH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5b3g_A | 2e-15 | 1 | 116 | 264 | 378 | Protein SCARECROW |
5b3h_A | 2e-15 | 1 | 116 | 263 | 377 | Protein SCARECROW |
5b3h_D | 2e-15 | 1 | 116 | 263 | 377 | Protein SCARECROW |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in plant development. {ECO:0000250}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT106412 | 1e-173 | BT106412.1 Picea glauca clone GQ03001_C01 mRNA sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010649367.1 | 2e-52 | PREDICTED: scarecrow-like protein 1 | ||||
Refseq | XP_019075083.1 | 2e-52 | PREDICTED: scarecrow-like protein 1 | ||||
Refseq | XP_019075084.1 | 2e-52 | PREDICTED: scarecrow-like protein 1 | ||||
Refseq | XP_019075085.1 | 2e-52 | PREDICTED: scarecrow-like protein 1 | ||||
Swissprot | Q9SDQ3 | 4e-47 | SCL1_ARATH; Scarecrow-like protein 1 | ||||
TrEMBL | A0A0B4U7X1 | 8e-73 | A0A0B4U7X1_PINRA; SCL7 (Fragment) | ||||
STRING | Aquca_014_00370.1 | 9e-52 | (Aquilegia coerulea) | ||||
STRING | VIT_04s0044g01370.t01 | 9e-52 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Representative plant | OGRP10802 | 2 | 9 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G21450.1 | 2e-49 | SCARECROW-like 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|