PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea

Family

LBD

Protein Properties

Length: 218aa MW: 23623.6 Da PI: 6.6161

Description

LBD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MA_10429262g0010	genome	ConGenIE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	145.6	1.4e-45	9	108	1	100
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 +CaaCk+lrrkC+++Cv+apyfp e+p+kfanvhk+FGasnv+k+l++l++++reda++sl+yeAear++dPvyG+vg i+ lq+q++ql++e MA_10429262g0010 9 PCAACKFLRRKCTSECVFAPYFPPEEPQKFANVHKIFGASNVTKILNDLEPHQREDAVNSLAYEAEARLKDPVYGCVGAISILQRQVQQLQKE 101 7****************************************************************************************** PP DUF260 94 lallkee 100 la++++ MA_10429262g0010 102 LAAAHAD 108 99875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50891	27.928	8	109	IPR004883	Lateral organ boundaries, LOB
Pfam	PF03195	1.1E-44	9	106	IPR004883	Lateral organ boundaries, LOB

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0010199	Biological Process	organ boundary specification between lateral organs and the meristem

Sequence ? help Back to Top
Protein Sequence Length: 218 aa Download sequence Send to blast
MASTSSNSPC AACKFLRRKC TSECVFAPYF PPEEPQKFAN VHKIFGASNV TKILNDLEPH 60 QREDAVNSLA YEAEARLKDP VYGCVGAISI LQRQVQQLQK ELAAAHADLL QYTSAAEPVL 120 NPHSPGSTLP TYSRFQMIHS AATEQQQQNL VEFPNSRELQ LTREQLLELA LRIGGSYEAG 180 LAALGMTNHA YALYPSPRPA SDGGSGSSGC SFGHLSSP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5ly0_A	2e-62	3	112	5	114	LOB family transfactor Ramosa2.1
5ly0_B	2e-62	3	112	5	114	LOB family transfactor Ramosa2.1
Search in ModeBase

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00581	DAP	Transfer from AT5G63090	Download

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	FJ104457	1e-148	FJ104457.2 Pinus taeda isolate 2080 anonymous locus 2_8995_01 genomic sequence.
GenBank	FJ104458	1e-148	FJ104458.2 Pinus taeda isolate 2084 anonymous locus 2_8995_01 genomic sequence.
GenBank	FJ104459	1e-148	FJ104459.1 Pinus taeda isolate 2082 anonymous locus 2_8995_01 genomic sequence.
GenBank	FJ104460	1e-148	FJ104460.2 Pinus taeda isolate 2090 anonymous locus 2_8995_01 genomic sequence.
GenBank	FJ104461	1e-148	FJ104461.2 Pinus taeda isolate 2094 anonymous locus 2_8995_01 genomic sequence.
GenBank	FJ104462	1e-148	FJ104462.2 Pinus taeda isolate 2085 anonymous locus 2_8995_01 genomic sequence.
GenBank	FJ104463	1e-148	FJ104463.1 Pinus taeda isolate 2087 anonymous locus 2_8995_01 genomic sequence.
GenBank	FJ104464	1e-148	FJ104464.2 Pinus taeda isolate 2093 anonymous locus 2_8995_01 genomic sequence.
GenBank	FJ104465	1e-148	FJ104465.2 Pinus taeda isolate 2088 anonymous locus 2_8995_01 genomic sequence.
GenBank	FJ104466	1e-148	FJ104466.2 Pinus taeda isolate 2081 anonymous locus 2_8995_01 genomic sequence.
GenBank	FJ104467	1e-148	FJ104467.2 Pinus taeda isolate 2092 anonymous locus 2_8995_01 genomic sequence.
GenBank	FJ104468	1e-148	FJ104468.2 Pinus taeda isolate 2086 anonymous locus 2_8995_01 genomic sequence.
GenBank	FJ104469	1e-148	FJ104469.1 Pinus taeda isolate 2095 anonymous locus 2_8995_01 genomic sequence.
GenBank	FJ104470	1e-148	FJ104470.1 Pinus taeda isolate 2091 anonymous locus 2_8995_01 genomic sequence.
GenBank	FJ104471	1e-148	FJ104471.1 Pinus taeda isolate 2089 anonymous locus 2_8995_01 genomic sequence.
GenBank	FJ104472	1e-148	FJ104472.2 Pinus taeda isolate 2096 anonymous locus 2_8995_01 genomic sequence.
GenBank	FJ104473	1e-148	FJ104473.2 Pinus taeda isolate 2083 anonymous locus 2_8995_01 genomic sequence.
GenBank	FJ104474	1e-148	FJ104474.2 Pinus taeda isolate 2079 anonymous locus 2_8995_01 genomic sequence.
GenBank	JQ262918	1e-148	JQ262918.1 Pinus radiata isolate 2097 hypothetical protein (2_8995_01) gene, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024403438.1	7e-69	LOB domain-containing protein 6-like
Swissprot	Q8L8Q3	3e-63	LBD25_ARATH; LOB domain-containing protein 25
TrEMBL	H9X0F3	6e-82	H9X0F3_PINTA; Uncharacterized protein (Fragment)
STRING	PP1S170_78V6.1	3e-68	(Physcomitrella patens)
STRING	PP1S170_93V6.1	6e-68	(Physcomitrella patens)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP60	16	318

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G27650.1	1e-65	LOB domain-containing protein 25

Publications ? help Back to Top
Kim M,Kim MJ,Pandey S,Kim J Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development. Plant Cell Physiol., 2016. 57(11): p. 2291-2299 [PMID:27519310]