![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lus10040780 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 203aa MW: 22085.7 Da PI: 8.7733 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 92.9 | 2.6e-29 | 30 | 82 | 2 | 55 |
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 +rl+Wtp+LH+rFv++v+ L G ++A+Pkti++lm+v+gLt+e+v+SHLQkYRl Lus10040780 30 ARLVWTPQLHKRFVDVVAYL-GVKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 82 79******************.9*******************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 9.296 | 24 | 85 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.97E-19 | 27 | 86 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 8.8E-30 | 28 | 87 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 1.1E-22 | 30 | 82 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 5.9E-8 | 32 | 81 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0042753 | Biological Process | positive regulation of circadian rhythm | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 203 aa Download sequence Send to blast |
MRKLDSEEAD SVLRPENSTD DPSGKALKRA RLVWTPQLHK RFVDVVAYLG VKNAVPKTIM 60 QLMNVEGLTR ENVASHLQKY RLYLKRMQGL STDGPSSSDQ LFASTPPPPS LQESGGVGGG 120 GGGGGGGGVP MPSPYQQVAA DAMMPGSMYG HMGIQQMGSN HHYHHYHHHH GFDRNAQYNN 180 YGSVVSFPQH HHPHQVAPND NM* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5lxu_A | 1e-32 | 29 | 85 | 1 | 57 | Transcription factor LUX |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that is essential for the generation of the circadian clock oscillation. Is necessary for activation of CCA1 and LHY expression. Is coregulated with TOC1 and seems to be repressed by CCA1 and LHY by direct binding of these proteins to the evening element in the LUX promoter. Directly regulates the expression of PRR9, a major component of the morning transcriptional feedback circuit, by binding specific sites on PRR9 promoter. Binds to its own promoter, inducing a negative auto-regulatory feedback loop within the core clock. Binds to ELF3 and associates with ELF4 in a diurnal complex which is required for the expression of the growth-promoting transcription factors PIF4 and PIF5 and subsequent hypocotyl growth in the early evening. {ECO:0000269|PubMed:16006522, ECO:0000269|PubMed:16164597, ECO:0000269|PubMed:21236673, ECO:0000269|PubMed:21753751, ECO:0000269|PubMed:22311777}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00014 | PBM | Transfer from AT3G46640 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lus10040780 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian oscillation with peaks at subjective dusk. {ECO:0000269|PubMed:16006522, ECO:0000269|PubMed:16164597, ECO:0000269|PubMed:17132630, ECO:0000269|PubMed:21753751}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021642585.1 | 2e-77 | transcription factor LUX-like | ||||
Swissprot | Q9SNB4 | 3e-55 | PCL1_ARATH; Transcription factor LUX | ||||
TrEMBL | A0A251M2V0 | 3e-75 | A0A251M2V0_MANES; Uncharacterized protein | ||||
STRING | Lus10040780 | 1e-147 | (Linum usitatissimum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6957 | 33 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G46640.3 | 8e-54 | G2-like family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Lus10040780 |
Publications ? help Back to Top | |||
---|---|---|---|
|