![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lus10038150 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 132aa MW: 14291 Da PI: 8.4592 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 52.8 | 5.4e-17 | 89 | 118 | 4 | 33 |
GATA 4 CgttkTplWRrgpdgnktLCnaCGlyyrkk 33 C+t +Tp+WRrgp g+ktLCnaCGl y k Lus10038150 89 CNTFDTPMWRRGPLGPKTLCNACGLEYHKD 118 **************************9886 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 6.1E-7 | 80 | 130 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 6.18E-11 | 88 | 119 | No hit | No description |
CDD | cd00202 | 7.79E-10 | 89 | 117 | No hit | No description |
PROSITE profile | PS50114 | 10.752 | 89 | 113 | IPR000679 | Zinc finger, GATA-type |
Pfam | PF00320 | 1.2E-14 | 89 | 119 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 1.2E-13 | 89 | 120 | IPR013088 | Zinc finger, NHR/GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 132 aa Download sequence Send to blast |
MQGGETDLRI GSSSGIVNEQ YGYGTPTFGM VNKDPNNNNY NYNYNNPSGV GVPTSAALAP 60 PLAALAPTDQ ATFVNDLMIP RNLKRRLFCN TFDTPMWRRG PLGPKTLCNA CGLEYHKDEN 120 KNKAMQASTS N* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lus10038150 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
STRING | Lus10038150 | 1e-93 | (Linum usitatissimum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF13778 | 16 | 22 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G20750.1 | 1e-13 | GATA transcription factor 29 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Lus10038150 |