![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lus10031096 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 114aa MW: 12407.2 Da PI: 10.7123 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 57.9 | 1.4e-18 | 30 | 63 | 1 | 34 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 Cs+Cg kTp+WR gp g ktLCnaCG++y++ + Lus10031096 30 CSHCGIQKTPQWRTGPHGAKTLCNACGVRYKSGR 63 *******************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 3.9E-15 | 24 | 74 | IPR000679 | Zinc finger, GATA-type |
PROSITE profile | PS50114 | 11.978 | 24 | 60 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 4.23E-16 | 26 | 88 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 7.4E-16 | 28 | 61 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 8.41E-14 | 29 | 78 | No hit | No description |
PROSITE pattern | PS00344 | 0 | 30 | 55 | IPR000679 | Zinc finger, GATA-type |
Pfam | PF00320 | 8.3E-17 | 30 | 64 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 114 aa Download sequence Send to blast |
MKKKQKKKEK PTAAVGNSDE ALPPAQQRKC SHCGIQKTPQ WRTGPHGAKT LCNACGVRYK 60 SGRLFPEYRP AGSPTFSNEM HSNSHRKVLE MRKRKEGEMS AASADPTPAG PGF* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lus10031096 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008796881.1 | 1e-41 | GATA transcription factor 5 | ||||
Swissprot | Q9FH57 | 5e-40 | GATA5_ARATH; GATA transcription factor 5 | ||||
TrEMBL | A0A059AGC6 | 2e-40 | A0A059AGC6_EUCGR; Uncharacterized protein | ||||
TrEMBL | A0A2H3YD55 | 2e-40 | A0A2H3YD55_PHODC; GATA transcription factor | ||||
STRING | Lus10031096 | 4e-79 | (Linum usitatissimum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1108 | 34 | 107 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G66320.2 | 2e-41 | GATA transcription factor 5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Lus10031096 |