![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lus10026588 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 110aa MW: 12593.5 Da PI: 4.9064 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 54.3 | 4.4e-17 | 9 | 60 | 1 | 53 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka 53 lp G+rF+Ptdeel+++yL+ k++g+ e+ ++++e+d++++ePwdLp++v++ Lus10026588 9 LPLGYRFQPTDEELITHYLRLKINGRYSEV-DAVPEIDVCRWEPWDLPAQVYT 60 699************************999.99***************64443 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.96E-17 | 5 | 63 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 18.066 | 9 | 109 | IPR003441 | NAC domain |
Pfam | PF02365 | 5.5E-8 | 10 | 68 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 110 aa Download sequence Send to blast |
MSALAVKSLP LGYRFQPTDE ELITHYLRLK INGRYSEVDA VPEIDVCRWE PWDLPAQVYT 60 IDEKENDKTR RIKISANVAG LEMFAGLEML LLNSQELNCQ LARRRNDVV* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (PubMed:18443413, PubMed:24329768). Calmodulin-regulated transcriptional repressor. Binds several synthetic promoters with randomly selected binding sites (PubMed:17947243). Functions synergistically with SNI1 as negative regulator of pathogen-induced PR1 expression and basal resistance to a virulent strain of P.syringae. Binds directly to the promoter of the PR1 gene (PubMed:22826500). Acts as positive regulator of innate immunity. Involved in the effector-triggered immunity (ETI) induction of immunity-related gene expression (PubMed:24329768). Mediates osmotic stress signaling in leaf senescence by up-regulating senescence-associated genes (PubMed:18443413). {ECO:0000269|PubMed:17947243, ECO:0000269|PubMed:18443413, ECO:0000269|PubMed:22826500, ECO:0000269|PubMed:24329768}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lus10026588 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016716496.1 | 4e-25 | PREDICTED: NAC domain-containing protein 14-like isoform X1 | ||||
Refseq | XP_016716497.1 | 5e-25 | PREDICTED: NAC domain-containing protein 14-like isoform X2 | ||||
Refseq | XP_016716498.1 | 5e-25 | PREDICTED: NAC domain-containing protein 14-like isoform X3 | ||||
Refseq | XP_016716500.1 | 5e-25 | PREDICTED: NAC domain-containing protein 14-like isoform X5 | ||||
Refseq | XP_017649420.1 | 5e-25 | PREDICTED: NAC domain-containing protein 14 isoform X1 | ||||
Refseq | XP_021633205.1 | 3e-25 | protein NTM1-like 9 | ||||
Refseq | XP_021674121.1 | 4e-25 | protein NTM1-like 9 | ||||
Swissprot | F4JN35 | 3e-25 | NTL9_ARATH; Protein NTM1-like 9 | ||||
TrEMBL | A0A1R3K6N4 | 4e-24 | A0A1R3K6N4_9ROSI; No apical meristem (NAM) protein | ||||
STRING | Lus10026588 | 4e-76 | (Linum usitatissimum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF16106 | 4 | 10 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G35580.2 | 1e-27 | NAC transcription factor-like 9 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Lus10026588 |
Publications ? help Back to Top | |||
---|---|---|---|
|