![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lus10023358 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 179aa MW: 19512.9 Da PI: 10.2355 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 102.7 | 3.5e-32 | 80 | 136 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep++VNaKQy++Il+RRq+Rak+e+e+k +ksrkpylheSRh hAl+R+Rg+gGrF Lus10023358 80 EEPVFVNAKQYHGILRRRQSRAKAESENKA-IKSRKPYLHESRHIHALKRARGCGGRF 136 69****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 7.6E-36 | 78 | 139 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 37.163 | 79 | 139 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 6.9E-27 | 81 | 136 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 3.5E-23 | 82 | 104 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 84 | 104 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 3.5E-23 | 113 | 136 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 179 aa Download sequence Send to blast |
MAHSAVATGN IPFSTAPLLG AGQAMVPQGY PYPDPYYRSI FPPYDSQQYA PQPYGGQPMV 60 HVQLMGLQQG GMPLPSDAVE EPVFVNAKQY HGILRRRQSR AKAESENKAI KSRKPYLHES 120 RHIHALKRAR GCGGRFLNSK KNEDKQVAKS NTASGDKSES NINLNSDRSD TASSKGKT* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 5e-21 | 79 | 143 | 1 | 65 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lus10023358 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018847860.1 | 7e-95 | PREDICTED: nuclear transcription factor Y subunit A-7 | ||||
Refseq | XP_018847861.1 | 7e-95 | PREDICTED: nuclear transcription factor Y subunit A-7 | ||||
Swissprot | Q84JP1 | 5e-62 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
TrEMBL | A0A2I4GVD2 | 2e-93 | A0A2I4GVD2_JUGRE; nuclear transcription factor Y subunit A-7 | ||||
STRING | Lus10023358 | 1e-130 | (Linum usitatissimum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5379 | 33 | 55 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G30500.2 | 1e-60 | nuclear factor Y, subunit A7 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Lus10023358 |
Publications ? help Back to Top | |||
---|---|---|---|
|