![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lus10013350 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
||||||||
Family | Trihelix | ||||||||
Protein Properties | Length: 84aa MW: 9015.03 Da PI: 9.6929 | ||||||||
Description | Trihelix family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | trihelix | 34.9 | 4e-11 | 39 | 76 | 2 | 39 |
trihelix 2 WtkqevlaLiearremeerlrrgklkkplWeevskkmr 39 Wt+q++ +Li+a++e++ l+rg+lk+++Weev++++ Lus10013350 39 WTHQQTVHLIQAYQEKWYGLNRGQLKATHWEEVAAAVV 76 **********************************9984 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF13837 | 6.0E-7 | 38 | 78 | No hit | No description |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 84 aa Download sequence Send to blast |
MSTPSPSSSS PPPNQPQSSS TPYSPAPPIS GKKPQPVPWT HQQTVHLIQA YQEKWYGLNR 60 GQLKATHWEE VAAAVVSRCG HNG* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lus10013350 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021678170.1 | 8e-24 | trihelix transcription factor ASIL1-like | ||||
Refseq | XP_021678171.1 | 8e-24 | trihelix transcription factor ASIL1-like | ||||
Refseq | XP_021678172.1 | 8e-24 | trihelix transcription factor ASIL1-like | ||||
Refseq | XP_021678173.1 | 8e-24 | trihelix transcription factor ASIL1-like | ||||
Refseq | XP_021678174.1 | 8e-24 | trihelix transcription factor ASIL1-like | ||||
TrEMBL | A0A2C9UP25 | 4e-22 | A0A2C9UP25_MANES; Uncharacterized protein | ||||
STRING | Lus10013350 | 3e-53 | (Linum usitatissimum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF10087 | 28 | 35 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G24860.1 | 2e-15 | Trihelix family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Lus10013350 |