![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj6g3v1720580.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 195aa MW: 20757 Da PI: 6.7938 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 186.9 | 1.4e-58 | 24 | 119 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 reqdrflPianvsrimkk+lPan+kisk+aketvqecvsefisf+t+easdkcq+ekrktingddllwa++tlGfedyveplk+yl+kyre+eg Lj6g3v1720580.2 24 REQDRFLPIANVSRIMKKALPANGKISKEAKETVQECVSEFISFITGEASDKCQKEKRKTINGDDLLWAMTTLGFEDYVEPLKIYLHKYREMEG 117 89******************************************************************************************** PP NF-YB 96 ek 97 ek Lj6g3v1720580.2 118 EK 119 97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 8.1E-55 | 22 | 128 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 8.85E-42 | 26 | 130 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.9E-28 | 29 | 93 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 3.7E-21 | 57 | 75 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 60 | 76 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 3.7E-21 | 76 | 94 | No hit | No description |
PRINTS | PR00615 | 3.7E-21 | 95 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 195 aa Download sequence Send to blast |
MAESDNESGG QTGGGHTGEL LGCREQDRFL PIANVSRIMK KALPANGKIS KEAKETVQEC 60 VSEFISFITG EASDKCQKEK RKTINGDDLL WAMTTLGFED YVEPLKIYLH KYREMEGEKT 120 GGMVQSGGGG GGGGGGGRSQ SEQRDLNNAA GESYGHGMPS SHHVMMMMGH HQHQSHMYGG 180 SGSGSGSPSS GRSTR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 1e-49 | 24 | 114 | 2 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-49 | 24 | 114 | 2 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj6g3v1720580.2 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020205702.1 | 1e-82 | nuclear transcription factor Y subunit B-3 | ||||
Swissprot | O23310 | 4e-70 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | A0A151R1B1 | 3e-81 | A0A151R1B1_CAJCA; Nuclear transcription factor Y subunit B-3 | ||||
STRING | XP_007147615.1 | 6e-79 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF591 | 34 | 150 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 6e-67 | nuclear factor Y, subunit B3 |
Publications ? help Back to Top | |||
---|---|---|---|
|