![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj5g3v1654150.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 175aa MW: 19447.6 Da PI: 5.3814 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 169.9 | 3e-53 | 27 | 121 | 2 | 96 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 reqdr+ Pianv+rimk++lP+nakisk+aket+qecvsef+sfvt+easdkc++ekrkt+ngdd++wal+tlGf+dy++plk yl+kyrel+g Lj5g3v1654150.1 27 REQDRLRPIANVGRIMKQILPSNAKISKEAKETMQECVSEFVSFVTGEASDKCHKEKRKTVNGDDVCWALGTLGFDDYADPLKRYLNKYRELDG 120 89*****************************************************************************************998 PP NF-YB 96 e 96 Lj5g3v1654150.1 121 G 121 5 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.4E-50 | 24 | 136 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.58E-38 | 29 | 135 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.9E-26 | 34 | 96 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 4.5E-19 | 60 | 78 | No hit | No description |
PRINTS | PR00615 | 4.5E-19 | 79 | 97 | No hit | No description |
PRINTS | PR00615 | 4.5E-19 | 98 | 116 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 175 aa Download sequence Send to blast |
MGEREAAFNI NYNFSDNTAE EDGIIIREQD RLRPIANVGR IMKQILPSNA KISKEAKETM 60 QECVSEFVSF VTGEASDKCH KEKRKTVNGD DVCWALGTLG FDDYADPLKR YLNKYRELDG 120 GRANQNKGNN SGDENNIEGY HNCEGKPPPA PGSSSNPVAM LKLNDRSSVP QSRGF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 3e-43 | 26 | 117 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 3e-43 | 26 | 117 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj5g3v1654150.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT137358 | 0.0 | BT137358.1 Lotus japonicus clone JCVI-FLLj-13H4 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_028775933.1 | 4e-70 | nuclear transcription factor Y subunit B-1-like | ||||
Swissprot | O82248 | 1e-57 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | I3SA61 | 1e-125 | I3SA61_LOTJA; Uncharacterized protein | ||||
STRING | GLYMA02G17310.1 | 4e-69 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF805 | 32 | 131 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 5e-60 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|