PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj3g3v0666910.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 187aa MW: 21402.5 Da PI: 10.0753 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 167.9 | 3.4e-52 | 16 | 141 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 lppGfrF Ptdeel+v+yL++kv+g++++l +i+e+d+yk++Pw Lp+k+ +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk +++ Lj3g3v0666910.1 16 LPPGFRFYPTDEELLVQYLCRKVAGHNFTL-PIIAEIDLYKFDPWVLPSKAIFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIITT 108 79*************************999.88***************7777799***********************************9999 PP NAM 95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128 +g++vg+kk Lvfy g+apkg+kt+W+mheyrl Lj3g3v0666910.1 109 -EGRKVGIKKALVFYVGKAPKGTKTNWIMHEYRL 141 .999****************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 5.49E-68 | 12 | 165 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 60.395 | 16 | 164 | IPR003441 | NAC domain |
Pfam | PF02365 | 6.5E-27 | 17 | 141 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 187 aa Download sequence Send to blast |
MTMGIPEKDP LSQLSLPPGF RFYPTDEELL VQYLCRKVAG HNFTLPIIAE IDLYKFDPWV 60 LPSKAIFGEK EWYFFSPRDR KYPNGSRPNR VAGSGYWKAT GTDKIITTEG RKVGIKKALV 120 FYVGKAPKGT KTNWIMHEYR LLDSSQKNTG SRLDDWVLCR IYKKNSSAQR AASNGTVSSR 180 EYTQYSN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-108 | 3 | 170 | 4 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-108 | 3 | 170 | 4 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-108 | 3 | 170 | 4 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-108 | 3 | 170 | 4 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-108 | 3 | 170 | 7 | 174 | NAC domain-containing protein 19 |
3swm_B | 1e-108 | 3 | 170 | 7 | 174 | NAC domain-containing protein 19 |
3swm_C | 1e-108 | 3 | 170 | 7 | 174 | NAC domain-containing protein 19 |
3swm_D | 1e-108 | 3 | 170 | 7 | 174 | NAC domain-containing protein 19 |
3swp_A | 1e-108 | 3 | 170 | 7 | 174 | NAC domain-containing protein 19 |
3swp_B | 1e-108 | 3 | 170 | 7 | 174 | NAC domain-containing protein 19 |
3swp_C | 1e-108 | 3 | 170 | 7 | 174 | NAC domain-containing protein 19 |
3swp_D | 1e-108 | 3 | 170 | 7 | 174 | NAC domain-containing protein 19 |
4dul_A | 1e-108 | 3 | 170 | 4 | 171 | NAC domain-containing protein 19 |
4dul_B | 1e-108 | 3 | 170 | 4 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Lja.6597 | 0.0 | cell culture| floral bud| flower| pod| protoplast| root |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in guard cells of the epidermis. {ECO:0000269|PubMed:25005917}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in guard cells of the epidermis. {ECO:0000269|PubMed:25005917}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in leaves. {ECO:0000269|PubMed:15319476}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in abscisic acid-mediated stomatal closure (PubMed:25005917). Regulates the expression of NCED1, a gene involved in the biosynthesis of abscisic acid (ABA) (PubMed:25005917). Required for the stomatal closure induced by the bacterial pathogen Pseudomonas syringae pv tomato DC3000, but not for stomatal reopening (PubMed:25005917). {ECO:0000269|PubMed:25005917}. | |||||
UniProt | Transcription factors that bind specifically to the 5'-CATGTG-3' motif. {ECO:0000269|PubMed:15319476}. | |||||
UniProt | Transcription factor that acts downstream of MYC2 in the jasmonate-mediated response to Botrytis cinerea infection (PubMed:28733419). With MYC2 forms a transcription module that regulates wounding-responsive genes (PubMed:28733419). Involved in jasmonate- and coronatine-mediated stomatal reopening in response to Pseudomonas syringae pv tomato DC3000 infection (PubMed:25005917). Regulates the expression of threonine deaminase 2 (TD2) through promoter binding (PubMed:28733419). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj3g3v0666910.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA), dehydration and wounding. {ECO:0000269|PubMed:25005917}. | |||||
UniProt | INDUCTION: Induced by jasmonate (JA) (PubMed:25005917, PubMed:28733419, PubMed:30610166). Induced by wounding (PubMed:28733419, PubMed:25005917). Induced by infection with the fungal pathogen Botrytis cinerea (PubMed:28733419). Induced by coronatine (PubMed:25005917). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419, ECO:0000269|PubMed:30610166}. | |||||
UniProt | INDUCTION: Strongly induced by high salinity. Slightly up-regulated by drought, abscisic acid (ABA) and jasmonic acid. Not induced by cold treatment. {ECO:0000269|PubMed:15319476}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014505280.1 | 1e-129 | NAC domain-containing protein 72 | ||||
Swissprot | A0A3Q7HH64 | 1e-110 | JA2L_SOLLC; NAC domain-containing protein JA2L | ||||
Swissprot | Q9LDY8 | 1e-110 | NAC55_ARATH; NAC domain-containing protein 55 | ||||
Swissprot | Q9SQL0 | 1e-110 | JA2_SOLLC; NAC domain-containing protein JA2 | ||||
TrEMBL | A0A1S3UGX4 | 1e-128 | A0A1S3UGX4_VIGRR; NAC domain-containing protein 72 | ||||
STRING | XP_007149614.1 | 1e-127 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF4429 | 33 | 60 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G15500.1 | 1e-112 | NAC domain containing protein 3 |