![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj3g3v0370510.3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 137aa MW: 15305.5 Da PI: 9.6564 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 34.1 | 6.1e-11 | 42 | 100 | 5 | 63 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 kr++r NR +A rs +RK +i+eLe+kv++L++e ++L +l l+ l se+ Lj3g3v0370510.3 42 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATSLSAQLTLLQRDTTGLNSEN 100 9**********************************************999988888877 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.1E-15 | 38 | 102 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.944 | 40 | 103 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 6.2E-10 | 42 | 100 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 7.2E-10 | 42 | 98 | No hit | No description |
SuperFamily | SSF57959 | 9.14E-12 | 42 | 94 | No hit | No description |
CDD | cd14703 | 1.90E-19 | 43 | 92 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 137 aa Download sequence Send to blast |
MDGSTSIKPE MLVSGSDEMS GVDSKKAMSA AKLAELALID PKRAKRIWAN RQSAARSKER 60 KMRYIAELER KVQTLQTEAT SLSAQLTLLQ RDTTGLNSEN SELKLRLQTM EQQVHLQDAL 120 NDALKEEIQH LKILAGQ |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Lja.22515 | 6e-74 | protoplast |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed constitutively at a low level in young seedlings and in roots, stems and leaves of mature plants. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor with an activatory role. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00126 | DAP | Transfer from AT1G06070 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj3g3v0370510.3 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004486898.1 | 5e-87 | probable transcription factor PosF21 | ||||
Refseq | XP_004486899.1 | 5e-87 | probable transcription factor PosF21 | ||||
Refseq | XP_004486900.1 | 5e-87 | probable transcription factor PosF21 | ||||
Swissprot | Q04088 | 1e-71 | POF21_ARATH; Probable transcription factor PosF21 | ||||
TrEMBL | A0A2Z6LS22 | 3e-86 | A0A2Z6LS22_TRISU; Uncharacterized protein | ||||
STRING | XP_004486898.1 | 2e-86 | (Cicer arietinum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G06070.1 | 7e-85 | bZIP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|