 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
Lj3g3v0129400.1 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
| Family |
SRS |
| Protein Properties |
Length: 112aa MW: 12373.7 Da PI: 5.4636 |
| Description |
SRS family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| Lj3g3v0129400.1 | genome | Kazusa | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | DUF702 | 67.5 | 4.4e-21 | 1 | 47 | 109 | 155 |
DUF702 109 vsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGleek 155
+ss+avf++vrv+s+dd+ +e+aYqt+v+igGh f+GiLydqG+e++
Lj3g3v0129400.1 1 MSSMAVFSSVRVRSMDDSVNEMAYQTSVNIGGHRFSGILYDQGPEQQ 47
689*****************************************986 PP
|
| Expression --
Description ? help
Back to Top |
| Source |
Description |
| Uniprot | DEVELOPMENTAL STAGE: In young plants, detected at a low level only in the root tips and lateral root primordia. In fully open flowers, primarily observed in the filaments and anthers. {ECO:0000269|PubMed:20706774}. |
| Uniprot | TISSUE SPECIFICITY: Mainly expressed in the filaments of flowers, the shoot apex regions and pollen. Also present in leaves. {ECO:0000269|PubMed:20706774}. |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influences vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). Regulates anther dehiscence and floral development. {ECO:0000269|PubMed:16740146, ECO:0000269|PubMed:20706774}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | AJ580823 | 1e-163 | AJ580823.1 Lotus corniculatus var. japonicus ORF1, ORF2, ORF3 and genes for vacuolar proton-ATPase subunit-like protein, papain-like cysteine proteinase-like protein 1 and papain-like cysteine proteinase-like protein 2. |
| GenBank | AP005666 | 1e-163 | AP005666.1 Lotus japonicus genomic DNA, chromosome 3, clone: LjT09E01, TM0258b. |
