![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj2g3v3291390.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 164aa MW: 17363.1 Da PI: 5.5967 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 107.1 | 1.1e-33 | 30 | 89 | 38 | 97 |
NF-YB 38 cvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 vsefisf+t+easdkcqrekrktingddllwa++tlGfedyveplkvyl+++re+ege+ Lj2g3v3291390.1 30 FVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVEPLKVYLQRFREIEGER 89 69********************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PRINTS | PR00615 | 4.6E-17 | 27 | 45 | No hit | No description |
Pfam | PF00808 | 1.2E-10 | 29 | 63 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
SuperFamily | SSF47113 | 1.15E-23 | 29 | 105 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 1.7E-29 | 30 | 98 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 4.6E-17 | 46 | 64 | No hit | No description |
PRINTS | PR00615 | 4.6E-17 | 65 | 83 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 164 aa Download sequence Send to blast |
MADSDNESGG THNAGGNGGE LSSPREQDRF VSEFISFITG EASDKCQREK RKTINGDDLL 60 WAMTTLGFED YVEPLKVYLQ RFREIEGERT VAARDKDSVA ISSSGGGGYE YGAPMGMMMH 120 HQGHVYGSGG FHQVPVTGVS GGAPVMGKGG PGYPSPGSSA GRPR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 1e-25 | 31 | 84 | 40 | 93 | NF-YB |
4awl_B | 1e-25 | 31 | 84 | 41 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 1e-25 | 31 | 84 | 41 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Lja.8412 | 6e-68 | cell culture| floral bud| flower| pod| root |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj2g3v3291390.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FQ379398 | 1e-40 | FQ379398.1 Vitis vinifera clone SS0AEB10YI23. | |||
GenBank | FQ389757 | 1e-40 | FQ389757.1 Vitis vinifera clone SS0AEB19YM07. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016166993.1 | 5e-73 | nuclear transcription factor Y subunit B-3 | ||||
Refseq | XP_025667034.1 | 5e-73 | nuclear transcription factor Y subunit B-3 | ||||
Refseq | XP_027930250.1 | 3e-73 | nuclear transcription factor Y subunit B-3-like | ||||
Swissprot | Q75IZ7 | 1e-43 | NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A444YFJ0 | 1e-71 | A0A444YFJ0_ARAHY; Uncharacterized protein | ||||
TrEMBL | A0A4D6KKW9 | 8e-72 | A0A4D6KKW9_VIGUN; Nuclear transcription factor Y | ||||
STRING | GLYMA18G08620.1 | 2e-69 | (Glycine max) | ||||
STRING | AET00771 | 2e-69 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF591 | 34 | 150 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 4e-40 | nuclear factor Y, subunit B3 |
Publications ? help Back to Top | |||
---|---|---|---|
|