PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj2g3v2017430.2
Organism
Lotus japonicus
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family MYB_related
Protein Properties Length: 70aa    MW: 8416.83 Da    PI: 10.411
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj2g3v2017430.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.77.3e-201459147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+WT+eEd+ l+++v+++G ++W+ +a+ ++ gR +kqc++rw+++
  Lj2g3v2017430.2 14 KGPWTKEEDDCLIELVRKYGLKRWSVVAKFLP-GRIGKQCRERWHNH 59
                     79******************************.************97 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.44E-23269IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-6218IPR009057Homeodomain-like
PROSITE profilePS5129429.298964IPR017930Myb domain
SMARTSM007175.4E-181362IPR001005SANT/Myb domain
PfamPF002491.8E-191459IPR001005SANT/Myb domain
CDDcd001676.46E-151659No hitNo description
Gene3DG3DSA:1.10.10.604.0E-241962IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 70 aa     Download sequence    Send to blast
MHRWQKVLNP ELVKGPWTKE EDDCLIELVR KYGLKRWSVV AKFLPGRIGK QCRERWHNHH  60
DPAITKVAWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-3317045114MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-3317045114MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in the root quiescent center (PubMed:15937229). Accumulates in division zone of primary root tips and emerging lateral roots. Also present in floral organs in young flower buds. Weakly and uniformly present in the developing embryo and maternal tissues (PubMed:17287251). Expressed specifically in proliferating stage of leaves (PubMed:26069325). {ECO:0000269|PubMed:15937229, ECO:0000269|PubMed:17287251, ECO:0000269|PubMed:26069325}.
UniprotTISSUE SPECIFICITY: Expressed in roots, cotyledons and leaves, especially in vascular tissues, and in flowers. {ECO:0000269|PubMed:17287251}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds 5'-AACGG-3' motifs in gene promoters (PubMed:21862669). Involved in the regulation of cytokinesis, probably via the activation of several G2/M phase-specific genes transcription (e.g. KNOLLE) (PubMed:17287251, PubMed:21862669, PubMed:25806785). Required for the maintenance of diploidy (PubMed:21862669). {ECO:0000269|PubMed:17287251, ECO:0000269|PubMed:21862669, ECO:0000269|PubMed:25806785}.; FUNCTION: Involved in transcription regulation during induced endoreduplication at the powdery mildew (e.g. G.orontii) infection site, thus promoting G.orontii growth and reproduction. {ECO:0000269|PubMed:20018666}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLj2g3v2017430.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Slightly induced by salicylic acid (SA) (PubMed:16463103). Expressed in a cell cycle-dependent manner, with highest levels 2 hours before the peak of mitotic index in cells synchronized by aphidicolin. Activated by CYCB1 (PubMed:17287251). Accumulates at powdery mildew (e.g. G.orontii) infected cells. {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:17287251}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0061486e-53AP006148.1 Lotus japonicus genomic DNA, chromosome 2, clone: LjT41D09, TM0304, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028118922.11e-38transcription factor MYB3R-4-like isoform X1
RefseqXP_028118923.11e-38transcription factor MYB3R-4-like isoform X1
RefseqXP_028118924.11e-38transcription factor MYB3R-4-like isoform X1
RefseqXP_028118925.11e-38transcription factor MYB3R-4-like isoform X1
RefseqXP_028118926.11e-38transcription factor MYB3R-4-like isoform X1
RefseqXP_028118927.11e-38transcription factor MYB3R-4-like isoform X1
RefseqXP_028118928.11e-38transcription factor MYB3R-4-like isoform X1
RefseqXP_028118929.18e-39transcription factor MYB3R-4-like isoform X2
SwissprotQ94FL96e-37MB3R4_ARATH; Transcription factor MYB3R-4
TrEMBLA0A371GBX91e-36A0A371GBX9_MUCPR; Transcription factor MYB3R-5 (Fragment)
STRINGXP_010676520.12e-36(Beta vulgaris)
STRINGAquca_001_00435.16e-36(Aquilegia coerulea)
STRINGXP_010249699.18e-36(Nelumbo nucifera)
STRINGA0A087G6B16e-36(Arabis alpina)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.13e-39myb domain protein 3r-4
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Saito T, et al.
    Genetic interaction between G2/M phase-specific transcription factor MYB3R4 and MAPKKK ANP3 for execution of cytokinesis in Arabidopsis thaliana.
    Plant Signal Behav, 2015. 10(3): p. e990817
    [PMID:25806785]
  3. Kobayashi K, et al.
    Transcriptional repression by MYB3R proteins regulates plant organ growth.
    EMBO J., 2015. 34(15): p. 1992-2007
    [PMID:26069325]
  4. Chen P, et al.
    Arabidopsis R1R2R3-Myb proteins are essential for inhibiting cell division in response to DNA damage.
    Nat Commun, 2017. 8(1): p. 635
    [PMID:28935922]