![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj2g3v1534090.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 64aa MW: 7263.41 Da PI: 8.6536 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 34.3 | 5.5e-11 | 14 | 45 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 rgrW++eEd++l d +kq G g+Wk+ ++ g Lj2g3v1534090.1 14 RGRWSEEEDKILTDFIKQNGEGSWKSLPKNAG 45 8*************************999877 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 5.1E-11 | 5 | 43 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 2.51E-8 | 8 | 45 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50090 | 7.027 | 9 | 42 | IPR017877 | Myb-like domain |
Pfam | PF00249 | 4.7E-8 | 14 | 45 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.64E-5 | 16 | 45 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 64 aa Download sequence Send to blast |
MGRAPCCEKV GLKRGRWSEE EDKILTDFIK QNGEGSWKSL PKNAGIYVHK FYINTCVAKC 60 LDIS |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: In seedlings, predominantly expressed in roots. Expressed predominantly in the root, in the vascular tissue of the hypocotyl-root transition zone and, at low levels, at the region of apical meristem and the apex of cotyledons. {ECO:0000269|PubMed:17419845}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in stems and flower buds (PubMed:9839469). Expressed in seedlings, roots, cotyledons and apical meristems (PubMed:17419845). {ECO:0000269|PubMed:17419845, ECO:0000269|PubMed:9839469}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Flavonol-specific transcription activator involved in the regulation of several genes of flavonoid biosynthesis. Activates the expression of CHS, CHI, F3H and FLS1. Controls flavonol biosynthesis mainly in the root (PubMed:17419845, PubMed:20731781). Confers tolerance to UV-B (PubMed:19895401). {ECO:0000269|PubMed:15923334, ECO:0000269|PubMed:17419845, ECO:0000269|PubMed:19895401, ECO:0000269|PubMed:20731781}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj2g3v1534090.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By nitrogen deficiency, sucrose and UV LIGHT (PubMed:17053893, PubMed:9839469). Triggered by HY5 in response to light and UV-B (PubMed:19895401). {ECO:0000269|PubMed:17053893, ECO:0000269|PubMed:19895401, ECO:0000269|PubMed:9839469}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022892153.1 | 2e-21 | transcription factor MYB12-like | ||||
Refseq | XP_027338876.1 | 2e-21 | transcription factor MYB111-like | ||||
Swissprot | O22264 | 3e-20 | MYB12_ARATH; Transcription factor MYB12 | ||||
TrEMBL | A0A2Z6P4Y9 | 8e-21 | A0A2Z6P4Y9_TRISU; Uncharacterized protein | ||||
TrEMBL | A0A444ZF87 | 6e-21 | A0A444ZF87_ARAHY; Uncharacterized protein | ||||
STRING | GLYMA17G03480.2 | 1e-20 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF31 | 34 | 817 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47460.1 | 1e-22 | myb domain protein 12 |