PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Lj2g3v1277750.1

Organism

Lotus japonicus

Taxonomic ID

34305

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus

Family

G2-like

Protein Properties

Length: 157aa MW: 18057.5 Da PI: 7.1437

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Lj2g3v1277750.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	101.7	4.8e-32	17	71	1	55
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 kprl+WtpeLH+rF+ea +qLGG+ekAtPk+++++m+++gLtl+h+kSHLQkYRl Lj2g3v1277750.1 17 KPRLKWTPELHQRFIEATNQLGGAEKATPKNLMRVMGIPGLTLYHLKSHLQKYRL 71 79****************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	4.9E-30	15	73	IPR009057	Homeodomain-like
SuperFamily	SSF46689	1.47E-16	16	72	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	3.5E-22	17	72	IPR006447	Myb domain, plants
Pfam	PF00249	7.7E-8	19	70	IPR001005	SANT/Myb domain
Pfam	PF14379	1.1E-20	117	157	IPR025756	MYB-CC type transcription factor, LHEQLE-containing domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 157 aa Download sequence Send to blast
MGLQNQSVHF VLSTDAKPRL KWTPELHQRF IEATNQLGGA EKATPKNLMR VMGIPGLTLY 60 HLKSHLQKYR LGKSQVLETC SDSKQEDDYD TETKSSDDHC SREISFGAQN QNTENLQIAE 120 ALQMQMEVQR KLYEQIEVQK HLQLRIEAQG KYLQSVL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6j4k_A	6e-23	16	73	1	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B	6e-23	16	73	1	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A	6e-23	17	73	1	57	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B	6e-23	17	73	1	57	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C	6e-23	17	73	1	57	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D	6e-23	17	73	1	57	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A	6e-23	16	73	1	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C	6e-23	16	73	1	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D	6e-23	16	73	1	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F	6e-23	16	73	1	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H	6e-23	16	73	1	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J	6e-23	16	73	1	58	Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in phloem and/or cambium. {ECO:0000269\|PubMed:15923329}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that may activate the transcription of specific genes involved in nitrogen uptake or assimilation (PubMed:15592750). Acts redundantly with MYR1 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269\|PubMed:21255164, ECO:0000305\|PubMed:15592750}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00331	DAP	Transfer from AT3G04030	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Lj2g3v1277750.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by nitrogen deficiency. {ECO:0000269\|PubMed:15592750}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT149460	0.0	BT149460.1 Lotus japonicus clone JCVI-FLLj-19J4 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027361407.1	1e-98	myb family transcription factor PHL8-like isoform X1
Swissprot	F4I274	1e-57	PHL8_ARATH; Myb family transcription factor PHL8
Swissprot	Q9SQQ9	1e-57	PHL9_ARATH; Myb-related protein 2
TrEMBL	I3T9R2	1e-111	I3T9R2_LOTJA; Uncharacterized protein
STRING	XP_007157612.1	2e-93	(Phaseolus vulgaris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF5218	32	53

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69580.1	5e-60	G2-like family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Nakano Y,Naito Y,Nakano T,Ohtsuki N,Suzuki K NSR1/MYR2 is a negative regulator of ASN1 expression and its possible involvement in regulation of nitrogen reutilization in Arabidopsis. Plant Sci., 2017. 263: p. 219-225 [PMID:28818378]