![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj2g3v1068520.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 42aa MW: 4501.2 Da PI: 8.5178 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 25.3 | 3.6e-08 | 12 | 41 | 1 | 30 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIart 30 +g+W++ Ed+ll +v ++G g W++++++ Lj2g3v1068520.1 12 KGAWSKVEDDLLTACVLKYGEGKWHLVPSR 41 79************************9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 10.865 | 7 | 42 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 5.23E-7 | 9 | 40 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 2.7E-9 | 9 | 41 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 3.8E-6 | 12 | 41 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.84E-4 | 14 | 41 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 42 aa Download sequence Send to blast |
MEGVGGSLGV RKGAWSKVED DLLTACVLKY GEGKWHLVPS RA |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj2g3v1068520.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019426716.1 | 2e-15 | PREDICTED: transcription factor MYB90-like |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G56650.1 | 8e-14 | production of anthocyanin pigment 1 |