PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus

Family

MYB

Protein Properties

Length: 241aa MW: 28515.7 Da PI: 8.3777

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Lj2g3v0632800.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	56.1	8.6e-18	4	49	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ede+l ++v+++G+++W++Ia+++ gR++k+c++rw++ Lj2g3v0632800.1 4 RGHWRPSEDEKLRELVERYGPHNWNAIAEKLK-GRSGKSCRLRWFNQ 49 899**************************9.*********996 PP
2	Myb_DNA-binding	57.8	2.5e-18	56	100	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r ++T+eE+e+l+ ++ +G++ W+ Iar+++ gRt++ +k++w+ Lj2g3v0632800.1 56 RSPFTEEEEERLLASHRIHGNR-WAVIARHFP-GRTDNAVKNHWHVM 100 789*****************.*****.*********975 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	25.682	1	54	IPR017930	Myb domain
SMART	SM00717	2.4E-15	3	52	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	8.24E-30	4	97	IPR009057	Homeodomain-like
Pfam	PF00249	1.6E-17	4	49	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.1E-27	5	57	IPR009057	Homeodomain-like
CDD	cd00167	1.26E-13	7	48	No hit	No description
PROSITE profile	PS51294	21.082	55	105	IPR017930	Myb domain
SMART	SM00717	1.7E-16	55	103	IPR001005	SANT/Myb domain
Pfam	PF00249	3.4E-15	56	99	IPR001005	SANT/Myb domain
CDD	cd00167	3.30E-12	58	101	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.4E-21	58	103	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009737	Biological Process	response to abscisic acid
GO:2000652	Biological Process	regulation of secondary cell wall biogenesis
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 241 aa Download sequence Send to blast
MCSRGHWRPS EDEKLRELVE RYGPHNWNAI AEKLKGRSGK SCRLRWFNQL DPRINRSPFT 60 EEEEERLLAS HRIHGNRWAV IARHFPGRTD NAVKNHWHVM MARNRRERYK EDVYAKGPLH 120 HTNNFSPQDH HQTNFETTTC LPSFVEKLYH EKYYPCVTYS PFRFPKRFNF QDPSSCSTKL 180 LQERSKSVEF YDFLQVNTES SKSEVTDNAR RDDEEVNQNA MGEQNKDCGV PFIDFLSTGS 240 S

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	1e-32	4	103	7	106	B-MYB
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in stamen (PubMed:19325888). Present in roots and siliques, and, at low levels, in leaves and flowers (PubMed:21399993). Expressed in stems, especially in fibers and, at lower levels, in xylems (PubMed:18952777, PubMed:21399993). {ECO:0000269\|PubMed:18952777, ECO:0000269\|PubMed:19325888, ECO:0000269\|PubMed:21399993}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269\|PubMed:18952777, ECO:0000269\|PubMed:21399993, ECO:0000269\|PubMed:23781226}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00145	DAP	Transfer from AT1G17950	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Lj2g3v0632800.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:19674407, ECO:0000269\|PubMed:21399993, ECO:0000269\|PubMed:22197883}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT092893	2e-96	BT092893.1 Soybean clone JCVI-FLGm-12J9 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027359336.1	1e-129	transcription factor MYB52-like
Swissprot	Q6R0C4	4e-84	MYB52_ARATH; Transcription factor MYB52
TrEMBL	A0A1S3DUP7	1e-125	A0A1S3DUP7_CICAR; transcription factor MYB52
STRING	GLYMA09G29940.1	1e-121	(Glycine max)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF230	34	243

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G17950.1	2e-86	myb domain protein 52

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Cassan-Wang H, et al. Identification of novel transcription factors regulating secondary cell wall formation in Arabidopsis. Front Plant Sci, 2013. 4: p. 189 [PMID:23781226] Shi D, et al. MYB52 Negatively Regulates Pectin Demethylesterification in Seed Coat Mucilage. Plant Physiol., 2018. 176(4): p. 2737-2749 [PMID:29440562]