PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus

Family

HSF

Protein Properties

Length: 85aa MW: 9652.99 Da PI: 4.4456

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Lj1g3v4241070.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	82.6	5.6e-26	26	85	2	61
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYg 61 Fl k+y ++ed++++e+isw+++g++fvv+++ efa+++Lp+ Fkhsnf+SFvRQLn+Yg Lj1g3v4241070.1 26 FLLKTYMLVEDPTTDEVISWNDEGTAFVVWQPAEFARDLLPTLFKHSNFSSFVRQLNTYG 85 9**********************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	2.5E-27	19	85	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	1.2E-18	22	85	IPR000232	Heat shock factor (HSF)-type, DNA-binding
SuperFamily	SSF46785	4.52E-24	24	85	IPR011991	Winged helix-turn-helix DNA-binding domain
Pfam	PF00447	8.2E-22	26	85	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	6.9E-17	26	49	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	6.9E-17	64	76	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	6.9E-17	77	85	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 85 aa Download sequence Send to blast
MDQGVVSDNK GLLLECGIRK CNPPPFLLKT YMLVEDPTTD EVISWNDEGT AFVVWQPAEF 60 ARDLLPTLFK HSNFSSFVRQ LNTYG

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
2ldu_A	1e-17	22	85	16	79	Heat shock factor protein 1
5d5u_B	1e-17	22	85	25	88	Heat shock factor protein 1
5d5v_B	1e-17	22	85	25	88	Heat shock factor protein 1
5d5v_D	1e-17	22	85	25	88	Heat shock factor protein 1
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Lja.5507	1e-141	floral bud\| root

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Lj1g3v4241070.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004493479.1	2e-46	LOW QUALITY PROTEIN: heat stress transcription factor B-3
Swissprot	Q7XRX3	4e-35	HFB2A_ORYSJ; Heat stress transcription factor B-2a
TrEMBL	A0A1S2XRP2	5e-45	A0A1S2XRP2_CICAR; LOW QUALITY PROTEIN: heat stress transcription factor B-3
STRING	XP_004493479.1	8e-46	(Cicer arietinum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1592	33	95

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G41690.1	3e-37	heat shock transcription factor B3

Publications ? help Back to Top
Nakayama A, et al. Genome-wide identification of WRKY45-regulated genes that mediate benzothiadiazole-induced defense responses in rice. BMC Plant Biol., 2013. 13: p. 150 [PMID:24093634]