PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus

Family

bZIP

Protein Properties

Length: 163aa MW: 18449.9 Da PI: 10.6128

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Lj1g3v4048460.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	51.2	2.6e-16	93	136	5	48
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 +r++r++kNRe+A rsR+RK+a+++eLe kv Le+eN++L+ + Lj1g3v4048460.1 93 RRQKRMIKNRESAARSRARKQAYTQELEIKVSRLEEENERLRRQ 136 79***************************************954 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.20.5.170	1.3E-15	86	136	No hit	No description
SMART	SM00338	1.5E-13	89	157	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	11.588	91	136	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	6.19E-12	93	139	No hit	No description
Pfam	PF00170	1.5E-13	93	136	IPR004827	Basic-leucine zipper domain
CDD	cd14707	1.72E-22	93	138	No hit	No description
PROSITE pattern	PS00036	0	96	111	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 163 aa Download sequence Send to blast
MQYQLPSVQQ QQPPQQQHQN PQNNMMTGFA GYMAGHVVQQ PLAVAVNPVL DAGYSEAMVT 60 VSPSSLMGTL SESQTPSRKR VASGIVVEKT VERRQKRMIK NRESAARSRA RKQAYTQELE 120 IKVSRLEEEN ERLRRQHEIE QVLPSVPPPD PKHQLRRTSS SPL

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed in embryo during the latest stages of seed maturation. {ECO:0000269\|PubMed:15642716}.
Uniprot	TISSUE SPECIFICITY: Predominantly expressed in seeds. {ECO:0000269\|PubMed:12376636}.

Functional Description ? help Back to Top
Source	Description
UniProt	Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Lj1g3v4048460.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003624832.1	2e-78	ABSCISIC ACID-INSENSITIVE 5-like protein 2
Swissprot	Q9LES3	9e-55	AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBL	Q2HUH2	3e-77	Q2HUH2_MEDTR; BZIP transcription factor
STRING	AES81050	6e-78	(Medicago truncatula)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1320	34	105

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G56850.1	8e-48	ABA-responsive element binding protein 3

Publications ? help Back to Top
Kim H, et al. ABA-HYPERSENSITIVE BTB/POZ PROTEIN 1 functions as a negative regulator in ABA-mediated inhibition of germination in Arabidopsis. Plant Mol. Biol., 2016. 90(3): p. 303-15 [PMID:26667153] Song C,Kim T,Chung WS,Lim CO The Arabidopsis Phytocystatin AtCYS5 Enhances Seed Germination and Seedling Growth under Heat Stress Conditions. Mol. Cells, 2017. 40(8): p. 577-586 [PMID:28756655]