![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj1g3v3716290.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 37aa MW: 4412.96 Da PI: 4.4288 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 28.3 | 4.2e-09 | 6 | 36 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 rg+W++++ el+++av+++G++ ++ I + ++ Lj1g3v3716290.1 6 RGKWSKQDTELFYEAVREFGTD-FSMIQQLFP 36 89*******************9.****99987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 10.309 | 1 | 37 | IPR017930 | Myb domain |
Pfam | PF15963 | 4.0E-13 | 3 | 37 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.7E-5 | 4 | 36 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 7.1E-8 | 5 | 37 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 37 aa Download sequence Send to blast |
MDKAPRGKWS KQDTELFYEA VREFGTDFSM IQQLFPD |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj1g3v3716290.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027359855.1 | 7e-18 | uncharacterized protein LOC113868459 isoform X1 | ||||
Refseq | XP_027359856.1 | 7e-18 | uncharacterized protein LOC113868459 isoform X2 | ||||
Refseq | XP_027359857.1 | 7e-18 | uncharacterized protein LOC113868459 isoform X3 | ||||
Refseq | XP_027359858.1 | 7e-18 | uncharacterized protein LOC113868459 isoform X4 | ||||
Refseq | XP_027359859.1 | 7e-18 | uncharacterized protein LOC113868459 isoform X5 | ||||
TrEMBL | A0A371IG69 | 2e-16 | A0A371IG69_MUCPR; Bdp1 (Fragment) | ||||
STRING | XP_004504018.1 | 2e-16 | (Cicer arietinum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G39160.2 | 2e-14 | MYB_related family protein |