PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj1g3v3642130.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 87aa MW: 10264.2 Da PI: 11.0095 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 57.8 | 2.4e-18 | 23 | 69 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT+ Ed l+++vk++G + W+ Ia+ +g gR +kqc++rw+++l Lj1g3v3642130.1 23 KGQWTPKEDGTLIELVKRFGLKKWSEIAKLLG-GRIGKQCRERWYNHL 69 799*****************************.*************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 26.169 | 18 | 73 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 7.8E-24 | 18 | 73 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 7.31E-19 | 19 | 76 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.2E-14 | 22 | 71 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.1E-17 | 23 | 69 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.70E-13 | 26 | 69 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 87 aa Download sequence Send to blast |
MLQKKRPKKS SEIQHKATPN IIKGQWTPKE DGTLIELVKR FGLKKWSEIA KLLGGRIGKQ 60 CRERWYNHLR ENIKVSFLST ILVLFYL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-19 | 19 | 76 | 3 | 60 | B-MYB |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in embryos from the early heart stage and throughout embryogenesis (PubMed:18695688, PubMed:19066902). Induced at the onset of the maturation phase in the endosperm, in a high and homogeneous repartition (PubMed:18695688, PubMed:19066902, PubMed:25194028, PubMed:27681170). {ECO:0000269|PubMed:18695688, ECO:0000269|PubMed:19066902, ECO:0000269|PubMed:25194028, ECO:0000269|PubMed:27681170}. | |||||
Uniprot | TISSUE SPECIFICITY: Mainly expressed in siliques (PubMed:18695688, PubMed:19066902). Also detected at low levels in leaves and flowers (PubMed:19066902). {ECO:0000269|PubMed:18695688, ECO:0000269|PubMed:19066902}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that recognizes the motif 5'-TAACGG-3' in the promoter of endosperm-induced genes (PubMed:27681170, PubMed:25194028, PubMed:19066902). Promotes vegetative-to-embryonic transition and the formation of somatic embryos from root explants in a WUS-independent manner but via the expression of embryonic genes (e.g. LEC1, LEC2, FUS3 and WUS) (PubMed:18695688). May play an important role during embryogenesis and seed maturation (PubMed:19066902, PubMed:25194028). Together with MYB115, activates the transcription of S-ACP-DES2/AAD2 and S-ACP-DES3/AAD3 thus promoting the biosynthesis of omega-7 monounsaturated fatty acid in seed endosperm (PubMed:27681170). Regulates negatively maturation genes in the endosperm (PubMed:25194028). {ECO:0000269|PubMed:18695688, ECO:0000269|PubMed:19066902, ECO:0000269|PubMed:25194028, ECO:0000269|PubMed:27681170}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj1g3v3642130.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by LEC2. {ECO:0000269|PubMed:25194028}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014626904.1 | 4e-27 | myb-related protein B isoform X1 | ||||
Swissprot | Q9LVW4 | 9e-22 | MY118_ARATH; Transcription factor MYB118 | ||||
TrEMBL | A0A251Q753 | 9e-26 | A0A251Q753_PRUPE; Uncharacterized protein | ||||
TrEMBL | A0A371F2M0 | 1e-25 | A0A371F2M0_MUCPR; Transcription factor MYB118 (Fragment) | ||||
STRING | GLYMA19G13923.1 | 1e-25 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF14336 | 10 | 18 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G27785.1 | 4e-24 | myb domain protein 118 |
Publications ? help Back to Top | |||
---|---|---|---|
|