PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj0g3v0350599.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 157aa MW: 17995.3 Da PI: 4.4927 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 30.4 | 8.4e-10 | 95 | 136 | 4 | 45 |
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaL 45 +k+++r ++NR +A +sR+RKk ++++Le k+ e+e ++L Lj0g3v0350599.1 95 SKKQIRQMRNRDSAVKSRERKKLYVKNLEMKSRYYEGECRRL 136 79****************************998888877666 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF00170 | 1.7E-7 | 95 | 133 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 6.75E-9 | 96 | 137 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 1.3E-9 | 96 | 136 | No hit | No description |
CDD | cd14704 | 1.29E-10 | 97 | 137 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 100 | 114 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 157 aa Download sequence Send to blast |
MDTSEQLDWE AFLEFEVDDF FMDAPPPSLA VGSSPDPVLS EIENLLMDDE PAVLPSESED 60 YDKLLAEILA EPHPHSDNSR VEPPTPEEAS NETVSKKQIR QMRNRDSAVK SRERKKLYVK 120 NLEMKSRYYE GECRRLAMLR IARCGFVCNR VAHLVLP |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Lja.13535 | 0.0 | cell culture| protoplast |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj0g3v0350599.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT138826 | 0.0 | BT138826.1 Lotus japonicus clone JCVI-FLLj-17J20 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013467378.1 | 3e-43 | bZIP transcription factor 60 | ||||
TrEMBL | I3SEC9 | 9e-94 | I3SEC9_LOTJA; Uncharacterized protein | ||||
STRING | XP_004514723.1 | 5e-40 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF12009 | 30 | 32 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G42990.1 | 5e-08 | basic region/leucine zipper motif 60 |