![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj0g3v0326419.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 126aa MW: 14140 Da PI: 4.9472 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 156.4 | 4.7e-49 | 2 | 97 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 ++qdr+lPianv+rimk+ lP akisk+ k+++qecv+ef+sfvt+easdkc++e+rkt+ngdd++wal++lGf++y++++ yl kyr++e++k Lj0g3v0326419.1 2 EDQDRLLPIANVGRIMKQNLPPSAKISKEGKQMMQECVTEFVSFVTGEASDKCHKENRKTVNGDDICWALSSLGFDNYADAVGRYLLKYRQAERDK 97 69*******************************************************************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.0E-45 | 2 | 98 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.71E-35 | 4 | 103 | IPR009072 | Histone-fold |
Pfam | PF00808 | 4.4E-25 | 7 | 71 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 5.1E-17 | 35 | 53 | No hit | No description |
PRINTS | PR00615 | 5.1E-17 | 54 | 72 | No hit | No description |
PRINTS | PR00615 | 5.1E-17 | 73 | 91 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 126 aa Download sequence Send to blast |
MEDQDRLLPI ANVGRIMKQN LPPSAKISKE GKQMMQECVT EFVSFVTGEA SDKCHKENRK 60 TVNGDDICWA LSSLGFDNYA DAVGRYLLKY RQAERDKIIM NQNQQILLAP LGCTEKDENS 120 PANESG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 1e-41 | 1 | 92 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-41 | 1 | 92 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers, siliques and young rosettes. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00133 | DAP | Transfer from AT1G09030 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj0g3v0326419.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC235914 | 1e-83 | AC235914.2 Glycine max clone GM_WBc0225O17, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_014511823.1 | 4e-63 | nuclear transcription factor Y subunit B-4 | ||||
Swissprot | O04027 | 8e-54 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | A0A1S3V0F5 | 8e-62 | A0A1S3V0F5_VIGRR; nuclear transcription factor Y subunit B-4 | ||||
STRING | XP_007144936.1 | 8e-60 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF805 | 32 | 131 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09030.1 | 3e-56 | nuclear factor Y, subunit B4 |
Publications ? help Back to Top | |||
---|---|---|---|
|