PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Lj0g3v0280059.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
||||||||
Family | Nin-like | ||||||||
Protein Properties | Length: 90aa MW: 10421.4 Da PI: 11.0738 | ||||||||
Description | Nin-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | RWP-RK | 69.2 | 5.8e-22 | 34 | 83 | 3 | 52 |
RWP-RK 3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 ++++ +++k+F +i+++Ak+++v+lT LK++CR++ I+RWPh k+ksl Lj0g3v0280059.1 34 RKLEFAEIKKHFGVKITEVAKNMNVGLTHLKKRCRELKIMRWPHKKLKSL 83 6899********************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51519 | 13.56 | 19 | 90 | IPR003035 | RWP-RK domain |
Pfam | PF02042 | 3.6E-20 | 36 | 83 | IPR003035 | RWP-RK domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 90 aa Download sequence Send to blast |
MEEEEKLEKM PMPLALMLPS SSSSKVRGVK SSSRKLEFAE IKKHFGVKIT EVAKNMNVGL 60 THLKKRCREL KIMRWPHKKL KSLNSRGNWS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Lj0g3v0280059.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT134923 | 1e-149 | BT134923.1 Lotus japonicus clone JCVI-FLLj-5K18 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019414766.1 | 8e-24 | PREDICTED: protein RKD2-like | ||||
Swissprot | Q9LVU8 | 1e-15 | RKD4_ARATH; Protein RKD4 | ||||
TrEMBL | I3S376 | 9e-57 | I3S376_LOTJA; Uncharacterized protein | ||||
STRING | GLYMA06G13540.2 | 2e-19 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF6898 | 32 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G53040.1 | 2e-17 | RWP-RK domain-containing protein |
Publications ? help Back to Top | |||
---|---|---|---|
|