PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus

Family

NAC

Protein Properties

Length: 53aa MW: 6393.32 Da PI: 5.6141

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Lj0g3v0184459.1	genome	Kazusa	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	64.5	3.2e-20	7	53	1	48
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48 +ppGfrFhPtdeelv++yL+kk+++k+++l +vik+vd+yk+ePwdL+ Lj0g3v0184459.1 7 VPPGFRFHPTDEELVDYYLRKKIASKRIDL-DVIKDVDLYKIEPWDLQ 53 69**************************.9************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.44E-19	5	52	IPR003441	NAC domain
PROSITE profile	PS51005	22.027	7	53	IPR003441	NAC domain
Pfam	PF02365	1.2E-9	8	50	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 53 aa Download sequence Send to blast
MNTFSHVPPG FRFHPTDEEL VDYYLRKKIA SKRIDLDVIK DVDLYKIEPW DLQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	2e-15	6	52	14	60	Stress-induced transcription factor NAC1
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Up-regulated during xylem vessel element formation. Expressed preferentially in procambial cells adjacent to root meristem. {ECO:0000269\|PubMed:16103214, ECO:0000269\|PubMed:25148240}.
Uniprot	TISSUE SPECIFICITY: Expressed in root, shoot and hypocotyl vascular elements, columella root caps, epidermal and cortex root cells and root-hypocotyl junctions. Observed predominantly in root imature xylem vessels (PubMed:18445131). Present in root developing xylems (PubMed:16103214, PubMed:17565617). Specifically expressed in vessels in the secondary xylem of the root-hypocotyl region, and in vessels but not in interfascicular fibers in stems (PubMed:25148240). {ECO:0000269\|PubMed:16103214, ECO:0000269\|PubMed:17565617, ECO:0000269\|PubMed:18445131, ECO:0000269\|PubMed:25148240}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250\|UniProtKB:Q9LVA1, ECO:0000269\|PubMed:16103214, ECO:0000269\|PubMed:25148240}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Lj0g3v0184459.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015034	7e-49	AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011018253.1	1e-30	PREDICTED: NAC domain-containing protein 7-like
Refseq	XP_011018254.1	1e-30	PREDICTED: NAC domain-containing protein 7-like
Refseq	XP_011018256.1	1e-30	PREDICTED: NAC domain-containing protein 7-like
Refseq	XP_022737577.1	9e-31	NAC domain-containing protein 7-like
Refseq	XP_022737578.1	9e-31	NAC domain-containing protein 7-like
Swissprot	Q9FWX2	2e-29	NAC7_ARATH; NAC domain-containing protein 7
TrEMBL	A0A438K3B4	2e-30	A0A438K3B4_VITVI; NAC domain-containing protein 7
STRING	XP_008238622.1	5e-30	(Prunus mume)
STRING	OMERI02G24390.1	4e-30	(Oryza meridionalis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF11433	17	39

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G12260.1	7e-32	NAC 007

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Heyndrickx KS,Vandepoele K Systematic identification of functional plant modules through the integration of complementary data sources. Plant Physiol., 2012. 159(3): p. 884-901 [PMID:22589469]