 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
Lj0g3v0099329.1 |
| Common Name | NAM-A43 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
|
| Family |
NAC |
| Protein Properties |
Length: 54aa MW: 6303.19 Da PI: 4.8792 |
| Description |
NAC family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| Lj0g3v0099329.1 | genome | Kazusa | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | NAM | 62 | 1.8e-19 | 7 | 53 | 1 | 48 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
lppGfrFhPtdeelv++yL+ k++g++++ +vike+d+yk++Pw+Lp
Lj0g3v0099329.1 7 LPPGFRFHPTDEELVNHYLCTKCAGQSFNY-SVIKEIDLYKFDPWQLP 53
79**************************99.99**************8 PP
|
| Expression -- UniGene
? help Back to Top |
| UniGene ID |
E-value |
Expressed in |
| Lja.6202 | 6e-87 | cell culture| floral bud| protoplast| root |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | AB378639 | 5e-84 | AB378639.1 Lotus japonicus NAM-A43 mRNA for transcription factor NAC, complete cds. |
| GenBank | BT136992 | 5e-84 | BT136992.1 Lotus japonicus clone JCVI-FLLj-4N12 unknown mRNA. |
| GenBank | BT145992 | 5e-84 | BT145992.1 Lotus japonicus clone JCVI-FLLj-17M21 unknown mRNA. |
| Publications
? help Back to Top |
- Asamizu E,Shimoda Y,Kouchi H,Tabata S,Sato S
A positive regulatory role for LjERF1 in the nodulation process is revealed by systematic analysis of nodule-associated transcription factors of Lotus japonicus.
Plant Physiol., 2008. 147(4): p. 2030-40
[PMID:18567832] - Florentin A,Damri M,Grafi G
Stress induces plant somatic cells to acquire some features of stem cells accompanied by selective chromatin reorganization.
Dev. Dyn., 2013. 242(10): p. 1121-33
[PMID:23798027] - Jensen MK, et al.
ATAF1 transcription factor directly regulates abscisic acid biosynthetic gene NCED3 in Arabidopsis thaliana.
FEBS Open Bio, 2013. 3: p. 321-7
[PMID:23951554] - Wang YX
Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress.
Mol. Biol. Rep., 2013. 40(11): p. 6451-8
[PMID:24057250] - Yang X, et al.
Overexpression of a Miscanthus lutarioriparius NAC gene MlNAC5 confers enhanced drought and cold tolerance in Arabidopsis.
Plant Cell Rep., 2015. 34(6): p. 943-58
[PMID:25666276] - Du Q,Wang H
The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation.
Plant Signal Behav, 2015. 10(10): p. e1078955
[PMID:26340415] - Takasaki H, et al.
SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence.
Plant J., 2015. 84(6): p. 1114-23
[PMID:26518251] - Liu Y,Sun J,Wu Y
Arabidopsis ATAF1 enhances the tolerance to salt stress and ABA in transgenic rice.
J. Plant Res., 2016. 129(5): p. 955-962
[PMID:27216423] - Ghandchi FP,Caetano-Anolles G,Clough SJ,Ort DR
Investigating the Control of Chlorophyll Degradation by Genomic Correlation Mining.
PLoS ONE, 2016. 11(9): p. e0162327
[PMID:27618630] - Zhao J,Missihoun TD,Bartels D
The ATAF1 transcription factor is a key regulator of aldehyde dehydrogenase 7B4 (ALDH7B4) gene expression in Arabidopsis thaliana.
Planta, 2018. 248(4): p. 1017-1027
[PMID:30027414]
|
