PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | LPERR05G19370.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 174aa MW: 18643.9 Da PI: 9.8041 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 103.3 | 1.4e-32 | 95 | 153 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+s+fprsYYrCt+++C+vkk+v+r a+d +v++tYeg Hnh+ LPERR05G19370.1 95 LDDGYRWRKYGQKAVKNSDFPRSYYRCTHHTCNVKKQVQRLAKDRGIVVTTYEGVHNHP 153 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 9.2E-33 | 81 | 153 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.31E-28 | 87 | 154 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.38 | 90 | 155 | IPR003657 | WRKY domain |
SMART | SM00774 | 7.2E-37 | 95 | 154 | IPR003657 | WRKY domain |
Pfam | PF03106 | 5.9E-26 | 96 | 153 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 174 aa Download sequence Send to blast |
MDGSLQAPDA YLASSSSTSL GSMAAAGDDW AASLLIMSGS STAAVESSTA TTTTAGGSSG 60 GGVTEAAVRR GKKAGGGRGR TPRYAFHTRS ENDILDDGYR WRKYGQKAVK NSDFPRSYYR 120 CTHHTCNVKK QVQRLAKDRG IVVTTYEGVH NHPCEKLMEA LSPILRQLQL LSQL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 3e-25 | 86 | 152 | 8 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 3e-25 | 86 | 152 | 8 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | LPERR05G19370.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU958074 | 2e-89 | EU958074.1 Zea mays clone 1671428 WRKY23 - superfamily of TFs having WRKY and zinc finger domains mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015639822.1 | 1e-69 | probable WRKY transcription factor 24 | ||||
Swissprot | Q9FFS3 | 5e-56 | WRK24_ARATH; Probable WRKY transcription factor 24 | ||||
TrEMBL | A0A0D9WIW7 | 1e-126 | A0A0D9WIW7_9ORYZ; Uncharacterized protein | ||||
STRING | LPERR05G19370.1 | 1e-126 | (Leersia perrieri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1100 | 38 | 133 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G64000.1 | 9e-55 | WRKY DNA-binding protein 56 |