PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | LPERR02G21340.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 179aa MW: 20035.7 Da PI: 9.1341 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 101.7 | 4.3e-32 | 104 | 162 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk+s +prsY+rCt+++C+vkk+ver ++d ++v++tYeg+H+h+ LPERR02G21340.1 104 LDDGYKWRKYGQKVVKNSLHPRSYFRCTHSNCRVKKRVERLSTDCRMVITTYEGRHTHS 162 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 2.0E-33 | 89 | 162 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.75E-28 | 96 | 162 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.552 | 99 | 161 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.7E-37 | 104 | 163 | IPR003657 | WRKY domain |
Pfam | PF03106 | 5.1E-25 | 105 | 161 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 179 aa Download sequence Send to blast |
MLSSDHCELY PLPVLPLGNS AAAATVAMGI KSTTTDSMPN IVGVEEVATS VTKVGSESNT 60 CNGSNTWWRG STMAAAGEKG KMKIRRKMRE PRFCFQTRSE VDVLDDGYKW RKYGQKVVKN 120 SLHPRSYFRC THSNCRVKKR VERLSTDCRM VITTYEGRHT HSPCDDNSSG EHINCFSSF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 5e-27 | 95 | 161 | 8 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 5e-27 | 95 | 161 | 8 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00618 | PBM | Transfer from AT2G44745 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | LPERR02G21340.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FP098149 | 1e-141 | FP098149.1 Phyllostachys edulis cDNA clone: bphyem124o14, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015624962.1 | 1e-112 | probable WRKY transcription factor 12 | ||||
Swissprot | Q93WY4 | 2e-62 | WRK12_ARATH; Probable WRKY transcription factor 12 | ||||
TrEMBL | A0A0D9VIZ3 | 1e-132 | A0A0D9VIZ3_9ORYZ; Uncharacterized protein | ||||
STRING | LPERR02G21340.2 | 1e-131 | (Leersia perrieri) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G44745.1 | 8e-65 | WRKY family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|